KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4311Help
Entry
Dmel_CG4311       CDS       T00030                                 

Gene name
Hmgs
Definition
(RefSeq) HMG coenzyme A synthase, isoform F
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00072  Synthesis and degradation of ketone bodies
dme00280  Valine, leucine and isoleucine degradation
dme00650  Butanoate metabolism
dme00900  Terpenoid backbone biosynthesis
dme01100  Metabolic pathways
Module
dme_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dmel_CG4311 (Hmgs)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dmel_CG4311 (Hmgs)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmel_CG4311 (Hmgs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dmel_CG4311 (Hmgs)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     Dmel_CG4311 (Hmgs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 44154
NCBI-ProteinID: NP_001286488
FlyBase: FBgn0010611
UniProt: Q7K4Q9
Position
2R
AA seq 465 aa AA seqDB search
MASHWPENVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSL
CLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNA
CYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLI
LDRGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQQKDTS
KQPASLSTFDAILFHTPFCKLVQKSVGRLSFNDFLLSSEEERTKQFPDLERFNTATLEST
YFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKR
IGLFSYGSGLAASMYSISVTQDAAAFEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREK
NNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYERTPTISNGVH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccactggcccgagaacgttggcatacgcgccatcgagattctcttcccctcc
cagtacgtggaccaaacggagctggagaccttcgatggtgcctccgcgggcaagtacaca
attggcctgggccaggccaagatgggcttctgctcggaccgcgaggatgtcaactctctc
tgcctgacggttgtgagccgcctgctggagcggcaacatgtgaagcactcggagatcgga
cgactggaggtgggcaccgagaccattgtggacaagtcgaagtcggtgaagtccgtgctg
atgcagctgttcgccgagagcgggaacacggacatcgagggcatcgacaccacgaacgcc
tgttacggcggcacggcggcgctcttcaatgccgtcaattgggtggaatcttctagctgg
gacggccgcctggctttggccgtttgtgctgatatcgccgtgtacgccaagggtgcagcg
cgcccaactggtggtgcgggtgctgtggctatgctggtgggtccaaatgcgccgcttatc
ctcgatcgtggactacgcgcaacgcacatggagcacgcctacgacttttacaagccggac
ctcagctccgaatacccaacggtagatggaaagctctctattcagtgctacctttctgct
ctggacacctgctacaggctgtatcgcaagaagttcgaccagcagcagaaggatacttcc
aagcagccggccagcctgagcaccttcgatgctatcctattccacacaccgttctgcaag
ttggtgcaaaaatctgtgggtcgcctgagcttcaacgatttcctgctgagcagtgaggag
gagcgaacgaagcagtttcccgacctggaacgttttaataccgctaccctggagagcacc
tactttgatcgcgatgtggagaaggccttcatgacgcagtccgccaacatctttgccagc
aagaccaagaaatcgctgctgctggccaaccaagtgggcaatatgtacacaccctcggtg
tactccggtttggtgtctctgttgattagcggaccagcccaggagctggtgggaaagcgc
attggtttgttctcctacggatccggactggctgcttccatgtactcgatcagcgtgacc
caggatgcagctgctttcgaaaagttcgtctcgcagctggactacgtgcagccgttgctg
aattcacgggagaaggttgcgcccgagcagttctccgcgctgatggaggtgcgggagaag
aacaaccatgcggcgccctacacgccaacgggcagcatctccgcactgtttcccggcacc
tactacctgaaggacgtggatgcgctgcatagacgcacctacgagcgcacaccgaccatc
agcaatggggtgcactaa

DBGET integrated database retrieval system