KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4317Help
Entry
Dmel_CG4317       CDS       T00030                                 

Gene name
Mipp2
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 2
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00010  Glycolysis / Gluconeogenesis
dme00562  Inositol phosphate metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG4317 (Mipp2)
   00562 Inositol phosphate metabolism
    Dmel_CG4317 (Mipp2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dmel_CG4317 (Mipp2)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dmel_CG4317 (Mipp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 31544
NCBI-ProteinID: NP_511055
FlyBase: FBgn0026060
UniProt: Q9W438
Position
X
AA seq 453 aa AA seqDB search
MLSQFYCLFLLLLHFFVGVTLSEEGECRRLNRADIEGRLSTKTPYRAIANYDETPPKYAG
CHPTRIWTIIRHGTRNPSESVILQAQNRLSEIKKRILDQTKPPICTAELEKLRQWHWMHL
NATEDEKLLVAEGEDELIELAERMQRRFPDLLPELYNPEWYYFKYTATQRTLKSAESFAT
GLFGRHRIHTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRFLAEPQMQSAVE
QVRSSTRLPDLQPEDVQLMYTVCAFETAWHRPRHDSGSKSSYESVWCNFFDVAALEALEF
FEDLEYYWNDGYGYELTHRIACPAIADMFAAISSSEETRQRRANATLYFTHSGTLLKLLA
HLGLARDNKPLTHKHFASERLWRTSQIDAFATNLAFLRYDCDKGNPQVLVLHQERVVRLP
GCPQDKDLCPLATLRRIYANSVDHCDREKMCRV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctaagccaattttactgcttgtttttgttgctcctccacttcttcgtgggcgtgacg
ttgtctgaagagggggagtgccgccgccttaatcgcgcagatatcgagggcagactgtcc
acaaagacgccctacagagcgatcgcaaattatgacgaaacgccaccgaaatacgccggc
tgccatccgacgcgaatttggaccatcatccgacacggaactagaaatcctagcgaatcc
gttatccttcaggcgcaaaatcgactatcagagataaagaaacgcattctggatcagacg
aagccgccgatctgcaccgctgaattggaaaagctgcgccaatggcactggatgcatctg
aatgccactgaagatgagaaattactggtggccgagggtgaggatgagctgattgagctg
gcggaacggatgcagcggcgatttccggatctacttccggagttgtacaatccggagtgg
tactacttcaagtatactgcgacccagagaacgctgaaaagtgcggaaagcttcgctacg
ggtttgttcggccgtcatcgcatccatactgtacgatatccgccgcctttgcacgaggat
cctgttttgcggttctataagggctgtggaaagtggaaaactgacgtcgataagaatccc
gaaaccttggtcaacgcacgcaggttccttgcagagccgcagatgcagtcagcagtggag
caggtacggagcagcacccggctaccagatcttcagccggaggacgttcagcttatgtac
acggtgtgcgctttcgagacggcctggcatcgcccacgtcacgactccggctcgaaatct
tcatacgaatccgtgtggtgtaacttctttgatgtggccgccttggaggcgctggaattc
ttcgaggatcttgagtactattggaacgatggctacggctacgaactgactcatcgcatt
gcctgtccagcaatcgcagatatgtttgcggccattagttcctctgaggagacacggcag
cgacgggccaacgccacgctgtacttcacgcactcgggtacgcttctcaaattgctggcc
cacctgggattggcccgggacaataagccgctgacgcacaaacactttgccagcgagcgt
ctttggcgcacaagccagattgacgcgttcgcgaccaacttggccttcctacgttacgac
tgcgacaaggggaatccgcaagtcctggtgctgcaccaggagcgagtggtgcgcctgccc
ggctgcccgcaggacaaggatctctgtccgctggccacgctgcgtcggatttacgccaat
agcgtggaccactgcgaccgcgagaagatgtgccgagtgtag

DBGET integrated database retrieval system