KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4320
Entry
Dmel_CG4320       CDS       T00030                                 

Gene name
raptor
Definition
(RefSeq) raptor, isoform C
  KO
K07204  regulatory associated protein of mTOR
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04136  Autophagy - other
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG4320 (raptor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG4320 (raptor)
   04136 Autophagy - other
    Dmel_CG4320 (raptor)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG4320 (raptor)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG4320 (raptor)
Membrane trafficking [BR:dme04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    Dmel_CG4320 (raptor)
SSDB
Motif
Pfam: Raptor_N HEAT HEAT_2
Other DBs
NCBI-GeneID: 31543
NCBI-ProteinID: NP_001284924
FlyBase: FBgn0029840
UniProt: Q9W437
Position
X
AA seq 1621 aa
MTSAVRAKSAAAAVGVAVDESSGSSNGSVADQEVASSKEAVLSVLIRKRYEKYVFAPWDD
PIILIMEQLEHIEHCRSAALGNQVAIGRDPSQDDSLNDLGKVISNMRQDQSLVPIVKHIE
QISDIQASNGQELASLGSLRELIRTIRKEWPRDDSIKLRLKEIQILGMPPARSLCFGERI
RDDRCPLSLQTKRHKERIQAMMYERQPWRIRERMKTASVALVLCLNIGVDPPDVVKIQPC
SRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRNA
KGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGI
IINSFQPYAKQHEEELGKALAAAQQRGGVQQLVGGSGGAANVAANQVQLTNQMVSYKNCI
HLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPGK
VNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHD
CTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEILDHNAPYRQLPFFEHQLTAFQVWLD
SESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQ
SSTRELRPVLVFIWAKILAVDPSCQVDLVKEYKYFLSVLQDTSVSKEHRTLSAFVLSSIV
HNFLLGQTSALQGPLLSICLEQLNDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEK
LYVLLRDSIPEVRAAAVFALGTFISSVTDRSEEQANNIDRIIAITMLETVGEDMSPLVRM
ELAAALQWMVVLFESQFVAVYLTEHMRGHVSAASFVMCPDPRDLTSSTHSLERHVTIRRG
ASSSSISNMGGASISSGTGSSSNPLGRSKSGSGSSGGRGAAGAAGGTNSIPFQSIFTKLW
LGICNLAQDPFPRVAAIAQEIVEHVRDTALCPIMAAKEATMANASEKCSSLSVSLPPSPN
TRVNYLGGGGAPGGAGATAESPPVGAAASGASHWAQKLRLSGSGACMGAGDPQTILQRKL
RTSSINDETDSGPGYSRGVAGAGTGLGLPSGPRESTHSARSSGSESNHYLEPGHSLTPIV
LTEFIPWAISYFTRPGKERYSSAEGSAEEGRQRFPVDRNSAELRRRRLRFLRNDFVRRHA
GRKHQELIDPYGFDVCVWNRKTQFTPSIVKLLPYEPQIAVAYREKVLVYDFQYNSVRTYG
AESLGGNFTGYSSGYGSGSGSSSSLNGSTPRKSGAHTSGGGGGGFSAAPFARVSSIEFIN
AQDMALNLVAHEDGVVRVWQSSPPASSATSEDTPSKARLVTAWTALGQVNQHNHRQRSVA
SGGSIGKGADASGLSSAAIGSGGIVTAWQQCSQHLVIGGGGCRFIRIWDVERELKLADIP
LGRSETCARVLSPYLPNMRSDVILAGCDDGSVRLFDKRCAPQDAGISVYRRHSAPILHAS
LRANGLVLVSGCTEGRISVADMRGSQSSINPFDVVYEWDAGGDVTAITSHQLEDTVACGN
ASKIVIYSLDGRQQKVLRTNEGFIGPKIGHPTYLYFHPYKAQLAVGFVDNTVAIYSPTPV
L
NT seq 4866 nt   +upstreamnt  +downstreamnt
atgacaagtgccgttcgcgctaagtccgccgctgccgcagtcggcgtcgcagtcgacgaa
agcagcggcagcagcaacggcagcgtcgcggatcaagaggtggcctccagcaaggaggcc
gtcctgagcgtcctaatccgcaagagatacgagaaatatgtattcgccccgtgggacgat
ccgataatcttgataatggagcaactggagcacatcgagcactgtcgatccgccgccttg
gggaaccaggtggccatcggccgggacccatctcaggacgactctctgaacgacctgggt
aaggtgattagcaacatgaggcaggaccaatcactggtaccaatcgtgaagcacatcgag
caaatatccgacattcaggcctccaacggccaggaactggcctccctcggttctttgagg
gagctaatccggactatcagaaaggaatggccccgggacgactctatcaaactgcggttg
aaggaaatacagatcctgggcatgccgcccgctcggagcttatgcttcggcgagcgtatc
cgcgacgacaggtgcccgctctccctgcagactaaaaggcacaaggagcgcatccaggcc
atgatgtacgagagacagccgtggcgcatccgcgagcgcatgaagacggcaagtgtggcc
ctggttctgtgcctcaacatcggcgtggatccgccggacgtggtcaagatccaaccctgc
tcacggctagagtgctggatagatcccagctcggtgtccccgccaaaggccatggaactc
attggaagcaacctgcagatgcagtacgaacgctggcagccaagggcccggtacaagaag
tgcaacgatcccaccgtggatgacgttaagaagctctgcacctccctacgccggaacgcc
aagggggagcgcatactcttccactacaacggacacggagtgcccaagcccacagccaac
ggggagatctgggtgttcaacaagaccttcacgcagtacatccccctgagcatattcgag
cttatcacttggatgtcagcgccctccatctacgtgtatgactgctccaacgccgggatc
atcatcaattcgtttcagccatacgctaaacagcacgaggaagaactagggaaggcgctg
gccgccgcccagcagaggggtggtgtccaacagttagtgggcggctctggtggtgccgcc
aacgtagccgccaaccaggtgcagttaaccaaccagatggtcagttacaagaactgtata
cacctggctgcctgtgctgcaaacgagattcttccgatgaatgcacagctgccggcggat
cttttcaccagctgtctgacaacacccattaacatagcgctcaagtggtacgccatgcaa
gaaaagctgggcatggtaccgcgtattcagagcgaactgatcgacaagattccaggcaag
gtcaacgaccggcgcactatgatgggtgagcttaactggatcttcaccgccattacggac
acgatagcatggaacacacttcctcgcgagctctttcagcgcctgtttcgccaggatctg
ctggtggccagcttgttccgcaatttcctgttggccgagcgcattctgcgaagccacgac
tgcacaccagtttccctgcctgccctgccgccttgttatcgccatccgatgtggaaggcc
tgggatctggtggtagatttggctctacagcagctgccggagattctcgatcacaatgcg
ccgtaccgccagctgccattcttcgagcaccagctcacggccttccaggtttggctggac
agcgaatcggagtcgagaacgccaccggaacagctgcccattgtgctgcaggtcctactg
tcgcaggtgcaccgtctgagggccttggagctgctggctcgctttctggatcttggtccg
tgggccgttaatctcgccctgggcgtgggcatctttccatacgtgcttaaactgctgcag
agttctacgcgcgaactgcgacccgttttggtgttcatttgggccaagatcctggccgtg
gatcccagctgccaggtggatctggtcaaggaatacaagtacttcctctccgtgctgcag
gacacctccgtttccaaggagcaccgtacactgtccgcctttgtattgtcctccatagtg
cacaacttcctgctgggacagacgagcgcgcttcaaggtcccctactgtctatttgcctt
gagcagttgaacgacggaagttggctgctgcgccagtggctagccatctgtctgggcatg
ctgtggcagaactttgagaaggcgcgttggtcgggagcacgcgacctggcgcacgagaag
ctgtacgtactgctgcgggactcgataccggaagtgagagccgctgccgtcttcgcctta
ggcacatttattagctccgtgacggatcgtagcgaggaacaggccaataatatcgatcgc
atcattgccattaccatgctcgaaaccgtcggcgaggatatgtcgccgctggtccgcatg
gagctggccgccgccctgcaatggatggtggtgctcttcgagtcacagttcgtggcagta
tatctaactgaacacatgcgcggtcacgtctccgccgcctcgttcgtgatgtgccccgat
ccccgggatctgacgtcttccacgcacagcctggagcgtcatgtgaccattcgcagggga
gccagctccagctccatatccaacatgggtggtgcgtcaataagctcgggaacaggatca
tccagcaaccctttgggtcgctcgaagagtggttctggcagttcgggtggaagaggagca
gccggagctgcgggtggtactaacagcataccctttcagtcaatctttaccaagctctgg
ctgggcatctgcaatctggcccaggatccgtttcctcgtgtagcggccattgcccaggag
attgttgaacatgtgagggacacggcactgtgtcccatcatggccgcaaaggaagccacc
atggccaatgcctcggagaaatgcagcagtctaagtgttagcctcccgcccagcccaaat
acaagagttaattacttgggcggtggcggtgcaccaggaggagctggcgcgactgcagaa
tcaccgcccgtcggagcagctgcctcgggcgccagtcactgggcacaaaagctacgacta
tcgggcagtggagcctgcatgggtgctggagatcctcaaaccattctgcagcgcaagctg
cgcaccagctccattaacgatgagacggacagcggaccagggtactccagaggagttgcg
ggtgccggaactggtctgggactgcccagtggaccgagggagagcacccattcggcgcgg
agcagcggcagcgagagcaatcattacctggagccaggacacagcctcacgcccattgtc
ctgaccgaattcataccctgggccatttcctatttcacacggcccggcaaggagcgctac
agcagcgccgagggatcggcagaggaggggcgccagcgcttcccagtggaccgaaactca
gcggagctgcgacgcaggaggttgcgcttcctgaggaacgatttcgtacgccgacatgcc
ggccgaaagcaccaggagctgatcgatccgtacggcttcgatgtgtgcgtatggaaccgg
aagacacagttcacgccttccatcgtgaagctgctgccttacgagccgcagattgcagtg
gcctacagggagaaggttctggtgtacgactttcagtacaattcggtacgcacatacggc
gccgagtctcttggcggcaacttcactggctatagttccggttacggatcaggttccgga
tcatcttcatcgctgaatggcagcactccgcgaaagtcgggcgcacatacaagtggagga
ggtggaggtggattttccgccgccccctttgcccgcgttagcagcatcgagtttatcaat
gcccaggatatggcgctcaacttggtggcacacgaagacggagtggtgcgcgtctggcaa
tcctcgccgccggccagctctgccacctccgaggataccccgagcaaagcccgattagtg
acggcttggacagctctgggccaggttaaccaacacaaccaccgtcagcgcagcgtggct
tccggcgggagcattggcaagggcgcggacgcatcgggactgtcgagcgcagcaattggc
tcgggaggcattgtgaccgcatggcagcaatgcagccagcacctcgtgataggcggcggt
ggctgccgatttatccgcatttgggacgtggaaagggaactgaaactggcagatattcca
ttgggtcgcagcgaaacctgcgcccgggtgctgtcaccctacctgcccaacatgcgttcc
gatgtgatcctcgccggctgcgacgacggcagtgtgcgactgtttgacaagcgttgtgcg
ccgcaggacgccgggatctccgtttatcgacgacacagtgcccccatcctccacgccagc
ctgcgggcaaacggactggtgctggtctccggctgcaccgaaggtcggatcagtgtggcg
gacatgcggggaagccagtcctccattaaccccttcgatgttgtgtacgagtgggacgcc
ggtggcgatgtgacggccataaccagccaccagttggaggacacggtggcctgcggcaat
gcctccaagatcgtgatctactcgctggacggacggcagcagaaggtgctgcggacgaac
gagggtttcattggtcccaagatcggtcaccccacgtatctgtattttcacccatacaaa
gcccagcttgcggtgggcttcgtggacaatacagtggccatatacagccccaccccagtt
ctataa

DBGET integrated database retrieval system