KEGG   Drosophila melanogaster (fruit fly): Dmel_CG43228Help
Entry
Dmel_CG43228      CDS       T00030                                 

Gene name
Diedel2
Definition
(RefSeq) diedel 2
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Diedel
Motif
Other DBs
NCBI-GeneID: 12798297
NCBI-ProteinID: NP_001247357
FlyBase: FBgn0262873
UniProt: A0A0B4K6M8
Position
3R
AA seq 125 aa AA seqDB search
MNQLTIAIFWLACINFASSTCCTFAATLHFKIRGGVCGVVGAKSNGTGCKITICPNGEAL
VGSYCGKAACDVFGCQCIRGCLQGSFAKDFLKKNYIHGIELLGTERTELCFLCQYIPKKI
EFEIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagctaacaatcgcgattttctggctggcatgcattaacttcgcctcttcgact
tgctgcacttttgcggcgactctgcacttcaagatccgtggcggagtctgtggagtggtg
ggtgcgaagagcaatggcactggctgcaagatcacaatttgccccaatggagaggccctc
gtgggaagctattgtggcaaggcggcgtgcgatgtatttggatgccaatgcattaggggc
tgccttcaaggatcttttgccaaggactttttgaaaaagaactacatacacggcatcgaa
ttgctgggcacagaaaggaccgagctgtgctttttgtgccaatacatacctaagaagatt
gaatttgaaataaattaa

DBGET integrated database retrieval system