KEGG   Drosophila melanogaster (fruit fly): Dmel_CG43313Help
Entry
Dmel_CG43313      CDS       T00030                                 

Gene name
CG43313
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K00747  chondroitin polymerizing factor [EC:2.4.1.175 2.4.1.226]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
dme01100  Metabolic pathways
Module
dme_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    Dmel_CG43313 (CG43313)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dme01003]
    Dmel_CG43313 (CG43313)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     Dmel_CG43313 (CG43313)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     Dmel_CG43313 (CG43313)
Glycosyltransferases [BR:dme01003]
 Glycan extension
  O-Glycan
   Dmel_CG43313 (CG43313)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHGN Fringe
Motif
Other DBs
NCBI-GeneID: 32259
NCBI-ProteinID: NP_001285184
FlyBase: FBgn0263005
UniProt: Q9VYH2
Position
X
AA seq 819 aa AA seqDB search
MRRPFTALNRNHYFVIGLLLGLLLSWHIPEDIWEEECPEEAAENLLIERFGQEFEPHLNL
INKPLAAKKPVKNVIRPRYYSSELGIREKLFIGVMTSQEHINTFATAFNRTTAHLVNKIK
FFIYADSVKTNYKLKNIVGFTDTRESRRPFHVVKYIADNYLDEYDYFLLVPDTVYVDARK
LVKLLYHMSITFDLYMGGARIGLDPSGGGASADGQSNEPPANEEEAPGASDRNYCSLEAG
ILLSSSVIRKMRNNLERCVRIGSTSDHSVNIGRCVKYASRVAGCQESFQGMRQFSYALDA
PGRRHREFSELAKEEAFRNASTVYPVQTPEDFYRLHAYYSKHHLEKVQERGYALEQKSYR
IANGSISNKILEIRWPLGVPPPSAPETRHDILTWQLLNGTHNFLPNGNAEHAVATLSRIE
AQDFAKVLEIALQYAALKHPRLSYHSLHSAYRKFDATRGMDYQLHLNLQEGSGRSRRLVI
KSFEVVKPLGRVEVVPSPYVTESTRIAMLVPAFEHQVPDALLFVEQYERICMQNQDNTFL
LLIFMYRLESPSKGDEDPFKALKTLALDLSSKYKTDGSRIAWVSIRLPEQLSEPVDPQSW
LLHASMYGPRQLLSLVVADLALPKLGLESLVLLATPGMVFKADFLNRVRMNTIQGFQVYA
PIGFQMYPCRWAHFCRECDTCDVSQSSGYFDRHNHDVIAFYSRDYVQARKLLHPQGLPII
RSDLDIDQLLLQPGEETRPPGVESILDMFVAAQHSVHILRGVEPNLRFGQDVRNHLARGG
TLPQSVPERCGREQCIHLASRKQIGDAIIRYEDKSILHK
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggccctttacagctttgaatcgcaatcactacttcgtcatcggcctgctcctg
ggcctcctgctcagctggcacattccggaggacatctgggaggaggagtgtcccgaggag
gccgccgagaatctgctaatcgagcgatttggccaggagttcgagccccacttgaacctg
atcaacaagccgctggcggccaagaagccggtgaaaaatgtgattcgaccgcgatactac
tcctcagagttgggtatacgggagaagctcttcatcggggtgatgacctcgcaggagcac
atcaacacctttgcgacggccttcaaccgcaccaccgcccacctggtgaacaagatcaag
ttcttcatttatgcggacagtgtaaagaccaactacaagctgaagaacatcgtgggattt
acggacacgcgggagagtcgccggccattccacgtggtcaagtatattgcggacaactat
ctggatgagtacgattatttcctgttggtgcccgataccgtctacgtggatgcgcgtaag
ctggtgaagttgctctatcacatgagcatcacctttgacctgtacatgggtggcgcacgc
atcggcctggatccttcgggtggcggtgcctccgccgatggccagtcgaatgaaccgccg
gcgaacgaggaggaggcacccggagccagtgatcgcaactattgctccttggaggcgggc
attctgctcagcagcagcgtcatacgcaagatgcgcaacaatctggagcgctgcgtccgg
atcggaagcaccagtgaccatagtgtcaacatcgggcggtgcgtcaagtacgccagtcgg
gtggccggatgccaggagagctttcagggcatgcggcaatttagctacgccttggatgcg
ccgggtcgtcgtcatcgcgaattcagcgaattggccaaagaggaggccttccgcaatgcc
agcaccgtgtatcccgtccagacgccggaggacttctaccgattgcatgcctactactcc
aagcaccatctggagaaggtgcaggagcggggctatgctctagagcagaaatcgtaccgg
attgccaatgggagtatatcgaacaagattctcgagatccggtggccattgggcgtgccg
ccacctagtgcgccggagacgcgtcacgacatcctcacgtggcagctgctcaatgggacg
cacaactttctgcccaatggcaatgcggagcatgcggtggcaacgctgtcgcggatcgag
gcacaggactttgccaaagtcctggagatagcactacagtatgccgcacttaagcatccg
cgcctgagctaccacagtctgcacagtgcctatcggaagttcgatgccacacgcggcatg
gactaccagctgcatctcaatctgcaggagggatcgggtcgcagtcgccggctcgtgatc
aagagcttcgaggtggttaagccactgggtcgcgtggaggtggtgccctcgccctacgtc
accgagagcacaagaattgccatgttggtgcccgcctttgagcaccaggtgccggatgct
ctgctgtttgtggaacagtacgaaaggatttgtatgcaaaatcaggacaacacattcctg
ttgctgatcttcatgtaccgactggagtcgcccagcaagggcgacgaggatcccttcaaa
gcactgaagacactggcccttgacttgtcatctaagtacaagaccgatggctctcggatc
gcctgggtgtccatccggctgccggagcagctgagcgaaccggtggatccgcagagctgg
ctgctgcacgcctccatgtatggaccacgccagcttctcagtctggtggttgcggatctg
gcactgcccaaactgggcctcgaatccctcgtgctgctggccacgccaggcatggtcttc
aaggcggactttctgaatcgcgtgcgcatgaacacgatacagggcttccaggtgtacgca
ccaatcggcttccagatgtacccatgccgctgggcgcatttctgccgtgagtgcgacacc
tgcgacgtgagccagagcagcggttacttcgatcgccataaccacgacgtgatcgctttc
tatagtcgggattatgtccaggctcgcaagctcttacatccgcagggactgccgatcata
cgcagcgacctggacatcgaccagctgctgctgcagcctggcgaggagacgcgaccaccg
ggcgtggaaagcattctcgatatgttcgtggcggcacagcactcggtgcatatactgcgc
ggagtggaaccgaatttgcgcttcggccaggatgtgcggaatcacttggcacgcggagga
acgctgccgcagagcgtgccggaacgctgcggtcgggagcagtgcatccacctggcgtcg
cgcaagcagatcggcgacgccataatacgctacgaggacaaaagtattctacacaaatag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9220Help
Entry
Dmel_CG9220       CDS       T00030                                 

Gene name
CG9220
Definition
(RefSeq) uncharacterized protein, isoform D
  KO
K13499  chondroitin sulfate synthase [EC:2.4.1.175 2.4.1.226]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
dme01100  Metabolic pathways
Module
dme_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    Dmel_CG9220 (CG9220)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dme01003]
    Dmel_CG9220 (CG9220)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     Dmel_CG9220 (CG9220)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     Dmel_CG9220 (CG9220)
Glycosyltransferases [BR:dme01003]
 Glycan extension
  O-Glycan
   Dmel_CG9220 (CG9220)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHGN Fringe Glycos_transf_2 Glyco_transf_7C Galactosyl_T Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 32497
NCBI-ProteinID: NP_001285280
FlyBase: FBgn0030662
UniProt: Q7KUZ9
Position
X
AA seq 832 aa AA seqDB search
MLQHTMTKRKTLIIGFFGIALGLCIGTMLKNYLALEIVKRCSLRPTNLKTPADIIGLRDE
DTIQNSQRNLVFVGVMTAKSFLEGRARAVYDTWGKEVPGRMAFFSSEGSYSDDLPVVGLK
NVDDRYPPQKKSFMMLYYMYEHYIDRFEWFIRADDDVYMEPDKLERFLRSIDSSKPQFIG
QAGKGNSEEFGLLSLEFDENFCMGGPGVILSSETLRRVAPHIPSCLKNLYSTHEDVEVGR
CVQKFAGIPCTWNYEMQYILRHNSSGRNAYTGKLKRKEIHNAITLHPIKQAPLMYRLHSY
VQGLKAEEMRQESLLLHRDIKRMAKYLEVPDESTYMLPSVSPESDSTKRHFQDHNILGIS
PELNKFVPASTDDLLDWSFIARSLYSASSANPKQKIDSAMREGLEDAITEVMENINNYSR
QRGRVIEFRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVRRHLYVQRAFTGIF
VKEVDEDFYNVTLQQSLLGSLFQNGMARLSSHFTMPSGLLSPTQDKIVFVLPIAGRLGTF
ERFLRTYERVCVRGEQHCDLLVVIFGSPDELGDHLQLLHDLHARHVYQQVNWIQRSSAFS
RGVALDVAARSSYIRQEDIILFIDVDMVFEVETLQRVRMHTQRGKQVYLPIVFSQYDPQR
RSGDAGGSEDEGETPRIDDERGYFRQFGFGICAIYKSDILDEDINGFDKDITGWGLEDVK
FLEKIVRVGTRQRGFLANTAELAMDYNEAAEQWRRLSVFRAPDPTLVHIYHDISCDVQLD
APQYNMCLGTKANSLGSTRLMEQLFHSSPENVQFAADFNRQKQQQQQQQQAR
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcacacgatgacgaagcggaagacgctgatcatcggcttctttggcatcgcc
ctgggcctctgcatcggcaccatgctgaagaactacctggcgctggagatcgtgaagcga
tgcagcctgcgcccgacgaatctcaagacgccggcggatatcattggactgcgggatgag
gacaccatacagaattcgcagcggaatctagtctttgtgggcgtgatgacggcgaaaagc
ttcctggagggcagagcgcgagcggtgtacgatacgtggggcaaggaggtgcccggccgg
atggccttcttcagttcggagggcagctactcggatgacctgcccgtggtggggctaaag
aacgtggacgatcgctatccgccgcagaagaagtccttcatgatgctgtactacatgtac
gagcactacatcgaccgcttcgagtggttcatccgggcggacgacgatgtctacatggag
ccggacaagctggagcgcttcctgcgctccatcgacagctccaagccgcagttcatcggc
caggcgggcaagggcaatagcgaggagttcggcctgctgtctctcgagttcgacgagaac
ttctgcatgggcggaccgggggtgatcctcagcagtgagactctgcgccgcgtggcgcca
cacatacccagctgcctgaagaacctctacagcacccacgaggacgtcgaggtggggcgg
tgtgtccagaagttcgccggcataccctgcacttggaactacgagatgcagtacattttg
cggcacaactccagtggacgaaatgcgtacacgggcaaactgaagcgcaaggagatccac
aacgccatcaccctgcatcccatcaaacaggcgccgctcatgtaccgcctgcactcctat
gtccagggtttgaaagcggaggagatgcgtcaggagtcgctgctgctgcatcgggatatc
aagcggatggccaaatatctggaggttccggacgagagcacctacatgttgcccagtgtg
tcacccgaaagcgattccaccaaaaggcacttccaggatcacaacatattaggaatcagt
ccggaactgaataaattcgtgcccgcaagcaccgacgacctgctggactggtccttcatc
gcccgcagcctgtactcggcaagttccgccaatcccaagcagaagatcgactcggcgatg
cgcgagggactggaggatgccatcaccgaggtgatggagaacatcaacaactattccagg
caacggggtcgcgtcatcgagttccgggaactgctctacggataccatcggctggacgcc
ctccacggccaggacatgatcctcgatctgctgctcatctacaagaagtaccggggcaag
aagatgaccgttccggtgcgaaggcatctttatgttcagcgcgcctttacgggcatcttt
gtcaaggaggtggacgaggacttctacaatgtcaccctgcagcaaagtctcctgggcagc
ctgttccagaacggaatggcccgcttgagcagccacttcacgatgccgagtggactgctg
tcaccgacgcaggacaagatcgtgttcgtcctgcccatcgccggtcgtttgggtacattc
gagcgcttcctgcgcacctacgagcgcgtctgcgtgcgtggcgaacagcactgcgacctc
ctggtggtgatcttcgggtcaccggacgagctgggcgatcacctgcagctgctccatgat
ctgcacgcccggcatgtctaccagcaggtgaactggattcaaagaagcagcgccttttcc
cgtggcgttgccctggacgtggccgccagatcctcgtacattcgtcaggaggacatcatt
ctgtttatcgacgtggacatggtcttcgaggtggagacgctgcagcgcgtgaggatgcac
acgcagcggggcaaacaggtttacctccccatcgtcttcagtcagtatgatccgcagagg
agaagcggtgacgctgggggatccgaggacgagggagaaacccccaggatcgacgacgaa
cgtggctatttccggcaatttgggttcggcatctgtgccatctacaagtcggacatactc
gatgaggatatcaacggattcgataaggacatcaccggctggggcctggaggacgtcaaa
ttcctggagaagatcgtgcgcgtaggcaccaggcaacggggcttcctagccaacaccgcc
gaactggccatggactacaacgaggccgctgagcagtggcgcagattgagtgtcttccgt
gcaccggatccaacgctggtccacatttaccatgacatcagctgcgacgtgcagctggat
gcgccgcagtacaacatgtgcctgggcaccaaggcaaactccctgggcagcacgcggcta
atggagcagctcttccacagcagtcccgaaaatgtccagtttgccgccgatttcaatcgc
caaaagcaacagcagcaacagcaacagcaggccaggtga

DBGET integrated database retrieval system