KEGG   Drosophila melanogaster (fruit fly): Dmel_CG43366
Entry
Dmel_CG43366      CDS       T00030                                 

Gene name
CG43366
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 35519
NCBI-ProteinID: NP_610188
FlyBase: FBgn0263109
UniProt: A1Z6I3
Position
2R
AA seq 2140 aa
MRLPRTFPALWLWAVLPLATPGILGYPNTQSQPALVTYVTTSSSSSQRGHSASPHLQPAF
VYESPLPEEEEGSKHSLATSTSSSTSDVRDEKTTESSKKVIGSSANPSVSVILDGNEPQF
TDALGHKVPKPQPSLQVASPIDLLNPDRYEFYTFDDHGELVKRLMTMQEIQSIVANGDGE
GPSIIHPAPLAESHPDKNVQDIVNSVQNVLNKEMASSSAKNSSGELLLPLLDTPDVSSSW
SLILPAIFGNTGGDIFPQQRPQQIVMTAESELLETPNKTPTGTTMATKKPKPAKRKPGTK
RKTTTTPSTTAVTPQVVQEELDPMESVYTGMQQYQQVAANMPHFELVHMQPIYQKQPSST
SERPETTTRRVFYNNQEIIHTPTSSSSAPSTTEVVLTHQLAKKPASVQRKPNQPHRVKKP
NGNGTTQTTSQAGKQKIKRKTTTTSTTTTTTTTPAPEPETQPPTQEEPVPATTESTTTTT
QAPASTTPKKKKRKPTRTPGTGSSGGSSKPSKPKRKPTSKPRPQIQEVSGSQIVVPQKPS
RPQRPTSNPSITSTMPAQEVTTTTTTFKPVITSTEPQTTEPPAESTVTTTSEPEPTTTSS
TQASTTTSTETYTTTSTEAPTTTVTAPTTTSIAPAKTTAIPPALHHQKLHNKPANRPLSQ
QHNHGLGRPVHYTTTESSKIVGEPQTETYGIVYVIHSSTTTHKPFYPLPSYNDDAVQNVS
TLLTPPPVQHKPLKKTPLPSLSQLQQQLHLGSPSPAPQLSPDQILSMDQIVQSLTQDLSA
SDKGEEASGASPVKYDSAESKLEIEALANKKKVAVVSSTTPASTTTPSSSSITTTPSKPT
KLSTSHKPLTSHYGGSTLATMLSEEDEDITEFTESSVVQQQPADTTISSLENENEDQTPV
VVITARPQYFTVTRVPEPLQHIKTDHRQEETETTELPGLTQFLVTTQMSQVDDDVDESTD
KSVVESVHENVSEASQSYPTDLEVKEEVPAAVVTTEQTTKLPVSETSTVAEMDSTEVTPL
IADLVQQLNLEMLKPTDQISMANFQTQAATVASTLVDGSNTLVSDVPLNSNETKDELEFL
ISDVIQQITQGDQNKLPPNAQPADDSNRLTSFAQLNTSFLLQPNIEKTEVNQIQQTHGTT
TAGPFKKESTYPEALPESPTHLETSTHRIPILSLSQIYAQQQQDEDEEQQVFANERIEVQ
STMETIGQETVATTEEIYTETPSVETTDADSVESTTPIEPQPQDPTQQTTSSEEGSGSEE
PTTTYSNIPESNTNRENEEEILQLLKNDTKEQKQTPNIDIQEKETEPEPSTSEEPGSTTQ
LSVVEEITLPTNIYQDAQEEEQSSTTEKHVYLEPQPQEAQIVVEVTDTNAAQLQPEYQYP
PSGEREEDKSPVTQIPGDMSLASSDSDMSLSSEQVTEKIELSTVKSQQLNDESMEEISDE
LTATISEEQDAESAEPVTSTQEIQLDNEDPYVKLGETTATVVRPLNPNSEGVGENKSATE
SDEDNYNYKVKLPLSNYGNPPVDQADEEDEDDQAAYHIPPMLASSTTVTTSSTKITITEA
PARSTSTTSVPPPTTKRLSTLKPVSYYVQPSLMGGYNQLDMQPPKVLPYNANKADPVQLQ
VPIHSQSMLNQQRPSQRPPLLINLMASSTQSTRPPVKLDPSPESSQGLEASTAMMDEDLQ
SFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKL
DDMVTFNPHLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGH
VEEVNFHVVNDIVRRRTNLLVKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGS
TTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYV
MPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNA
SLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYP
APPLRKRNKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPR
QARVPDAPRLRFDKPFLYFVRHNPTGMILFMGRFNPRLLP
NT seq 6423 nt   +upstreamnt  +downstreamnt
atgcgtctaccgcgcacttttccagcgctttggctctgggccgtgctacccttggccacc
cccggcattctgggctatccaaacacccagtcacagccggcactggtcacctatgtgacg
acctcgtcgtcgtccagtcagcggggccactccgccagtccgcacctacagcccgcattc
gtctatgagtcaccccttccggaagaggaagaaggttccaagcattcactggccacatcc
acatcctcatccacatccgatgtccgagacgagaagacgaccgagtcgtcaaagaaagtc
ataggttccagtgcaaacccttcagtgtccgtgattctcgacggaaatgagccgcaattt
acagatgcccttggacacaaagttcccaaaccacagccatcattgcaagtggctagtcca
atcgatctccttaacccagaccgctacgaattctatacgttcgacgatcacggcgagcta
gtcaagcggttgatgaccatgcaggagattcagagtatcgttgctaacggtgacggcgag
ggaccatcgataattcatccggctccgctagctgagagccatcccgataagaatgtccaa
gacatagtgaacagtgtgcaaaatgtcttgaataaggagatggcctccagctcagcaaag
aatagctctggggaactgcttcttcctctgttggacacgcccgacgtctcatcgtcttgg
tcactaattttgcccgccattttcggcaacactggtggggatattttccctcagcagcgc
ccacagcaaattgtgatgacggccgaatcggaacttctggaaacgcccaataagacgccg
acaggaacaacgatggccacaaagaaaccgaagcccgcgaagcgtaagccggggacaaag
cgtaagacgactacaactcccagcactaccgctgtaactccgcaggtggtgcaggaggag
ctggacccaatggagtccgtgtacacgggaatgcagcaataccagcaggttgccgcaaat
atgccacattttgagctcgtgcacatgcagcccatctaccagaagcaaccgagcagcaca
tcagagcgtccggaaacgaccacacgaagggtattttacaacaaccaagagataatccac
acgcccacctcctcgagcagcgccccttctaccacagaagttgtgctcacccaccagctg
gccaagaagccggctagtgtgcagcgcaagccgaaccagccacatcgagtgaaaaagcct
aacggtaatggtacaactcaaactacatctcaagccggaaagcagaagatcaaaagaaag
acaactaccacgtcaacgacgacgacaacaacaaccacaccggctccagagcctgaaaca
cagccacccactcaggaggagcctgttccagcaacaacagaaagtacgacaacaacgaca
caagcacccgcatcgaccacacccaaaaagaagaaacgaaaacccaccagaacaccgggt
acaggatcttctggtggcagctccaagccttccaagccaaaacgtaagccaacgtctaag
cccaggccacagatccaggaagtaagtggatcgcagattgtggtacctcaaaagccttcc
agaccgcagagaccaacaagtaacccatctatcacttcaacaatgccagcgcaagaagta
accactacaactaccactttcaaaccagtgatcacaagcactgagccccaaacaacagag
ccaccggcagagagtacggttaccaccacttccgaaccagagcctacaacaacgagttca
acacaggcttctactacaacatcaactgaaacatacacaacaacatccaccgaggcgccc
acaacaacagtgactgctcctactacaacaagcattgcaccggctaagaccacggcaata
ccaccagcattacaccatcagaaattgcacaacaaacctgcaaaccgtccactgtcccag
caacacaaccatggattaggtcgtccagttcattacaccacaactgagtcgagcaagatt
gttggggagccgcaaaccgagacctatggcatagtttacgtcattcattcctccaccacc
acacacaaaccgttttatccgctaccaagctacaacgatgacgccgtccaaaatgtgtct
actttactaactccaccaccagtgcaacataagcctctgaaaaagacgccgcttccttcg
ctgtcacaactgcagcagcaattgcaccttggctcaccatcgccggctccacagctctcg
ccagatcagattctctccatggatcaaatagtgcagtcacttacccaggacttgtcggcg
tcagacaagggtgaagaggcttctggtgcaagtccggtgaaatacgacagtgcagagagc
aagctcgagatagaggcactagccaacaagaagaaagtagcagtcgtatccagcaccact
ccggcttcaacaactacgccttcaagttcttctattacaacaacccccagcaagcccacc
aaattatcgaccagccacaagccgcttacttcccactacggaggcagtactttggccacg
atgctctcagaggaagatgaggatatcaccgaattcacagaatcttcagtggtccagcag
caaccagcagataccactatcagcagccttgagaatgaaaacgaggaccaaacacctgta
gttgtgatcaccgctagaccacaatactttacagtaacaagggtgccggagccactacag
cacataaagactgatcacagacaggaggagacggagaccaccgagttgcccggactgaca
cagtttctagttacaacgcagatgtcacaagtggatgatgacgttgacgaaagtacagat
aagtctgttgtagagtcagttcacgaaaacgtatcagaagctagccaatcataccccact
gacctagaagtgaaggaggaggtgcctgcagcggttgtcaccacagaacagactactaaa
cttccagtctcggagaccagcacagtcgctgaaatggacagtaccgaagtaacccccctg
atcgccgacctcgttcagcaactcaacctagaaatgctcaagcccacggaccaaatatca
atggccaattttcagacccaggcggccactgtggcctcaacgttagttgacggcagcaat
actcttgtctcagacgttcctttaaactcgaacgaaacaaaggatgagttggaattcctt
atatccgatgttatccagcaaataacccaaggcgatcaaaacaagctcccgccaaacgcc
caaccagccgacgattccaatcgcctgaccagtttcgcccaactgaatacctccttcttg
ctccagccaaacatagaaaaaacggaggtaaaccaaatacagcagacgcacggtacaaca
accgcgggtccgttcaagaaggaatccacatatccggaagctttgcctgaaagtccaacg
cacttagagacaagcacccaccgtataccgattttatcgctgtcccagatttatgcgcag
caacagcaagacgaagatgaggagcagcaagtttttgccaatgaacgaatagaagttcaa
tcaactatggagaccattgggcaggaaaccgttgcaacgacagaggagatatacacagaa
accccttccgtggaaaccaccgatgctgacagtgttgaatccaccacacccatcgagcct
caaccacaagatcccacccagcagaccacttctagcgaggagggttccggcagcgaagaa
ccaacgactacctatagcaacattcctgaaagcaacacgaaccgggaaaatgaagaggaa
atactgcagctcttaaaaaatgataccaaggagcagaagcagacgccgaacatagatatc
caagaaaaggagacagagcccgagccttccacgtcggaagagcctgggtcaacaacgcag
ctgtccgtggtagaagaaataacactaccaactaatatttaccaagatgcccaggaagaa
gagcaatcatcaacgacggaaaagcatgtgtacttagaaccacagccgcaggaagcccaa
attgtggtggaggtcactgacaccaacgccgcgcaactgcagcctgagtatcaatatcca
cccagcggagaacgggaggaggataaatcaccggtcactcaaattcccggtgatatgtcc
ttggcatcttcagattctgacatgtcgctaagctccgagcaggttactgagaaaatcgag
ttgagcacagtgaaatcgcaacaactgaacgacgagtcgatggaagaaatttccgacgaa
cttacagctaccatttcggaagaacaggatgctgaaagtgcggagccagtaacaagtacc
caagaaatacagctggacaatgaggatccctacgtaaagctaggcgaaacaacagcgact
gtagttaggcctctgaaccccaattccgaaggagtcggcgagaataagagcgcaactgaa
tcagacgaggataactataactacaaggtgaaattgccccttagcaactacgggaatccg
ccagtagatcaagcggatgaagaagacgaggatgatcaagcagcttaccacatacctccc
atgctggctagcagtacaactgtaacgacgagcagtactaaaataactattacagaagcc
ccagctaggtcaacaagtactactagtgtccccccaccaacaacaaagcgactaagcact
ttaaagccagtttcctactacgttcaaccctcgctaatggggggatacaaccaactggat
atgcagccgccaaaggttctgccttacaatgcgaataaggcagacccggtccaactacaa
gtcccgatccatagtcaatcgatgctcaaccagcagcgtccctcccaacggccacctttg
ctaatcaatctgatggccagctccacacaatcaactcgaccacccgtaaagctagaccca
agtcccgagtcctctcaggggctggaggcctccaccgcgatgatggatgaggatctgcaa
tccttcgcccgcctctgcaacgagctggcctttagctactggcgagctataacctcggag
aagatcagctccgccagaagtttggtcatatccccatttgccctcacgtccatgctttct
atggtctttctgggagcgcgcggtagcacttctggcgagatgaacgagatcctgaaattg
gacgacatggtcaccttcaatccgcacctcatcttcaagaatataaccaactcagtggaa
caagcttcggacagcgatatagcgactgctgcttttgtgcgtgaaatattcagcgatagg
gccaacggaaaaattctacccttctttaaggagaagacccagcagctttacgccggacat
gttgaggaggttaactttcacgtggttaacgacatcgtgagacgtcgaaccaaccttctg
gtgaaacgccacacgatggggaaggttcttgagtatctacgtacaaatagcgtatgggta
aacggaccattggccaccatctcggccaatcttttccagacagactgctcgcatggctcc
accactgatcgtgatggagagatgttcttccaagtgcatcctacagttcgccagcgccgg
ctcgtgcctattccagcagtgttgtaccgttccggcttcttggcagggtatgaacccagc
ctggacgccaccgtcgtttccttcggtcgagttcagaacactgttagcacagtctatgta
atgcctggccaccagagctccatttctccgatggacaacctcgaccgactcgagcgcagt
ctagtggagacggcgtttagtgacaagcaggcctggcgtaggttgctcacgtcccttatg
gatcgaccaggaatggaggtgcaactgccgcgcttttcacaccgctctttcgttaacgcc
tctctgggtctgcaaaagatgggtctacgcggtctcttcaagtctgactttgccgacctg
cggggtctaactggcgccggaaatcgcgacatcttcctgtccgacatgatacagatcaac
acgttcagcacctgcggcgaggagaagatctcggaacaccaccatgtggaaatgtacccc
gcgccaccactgcgtaagcgaaacaaggacgtagatgccacagatgacgacgcctttgat
tcttcggagagggtcgtggacttcggctcgttggtgcaggaatctgcactgggacgaggc
ttctacgatgaccttctggacccgaaatacttggaactgccgttgccactccgtccacgc
caggctcgtgtccctgacgctccacgactgcgcttcgacaagcctttcttatactttgtg
cgccacaaccctacgggtatgattctattcatggggcgttttaatccccgactgctgccg
tga

DBGET integrated database retrieval system