KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4380Help
Entry
Dmel_CG4380       CDS       T00030                                 

Gene name
usp
Definition
(RefSeq) ultraspiracle, isoform B
  KO
K14030  nuclear receptor subfamily 2 group B member 4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG4380 (usp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG4380 (usp)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dme03310]
    Dmel_CG4380 (usp)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    Dmel_CG4380 (usp)
Nuclear receptors [BR:dme03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   Dmel_CG4380 (usp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 31165
NCBI-ProteinID: NP_001259168
FlyBase: FBgn0003964
UniProt: P20153 M9PGS2
Structure
PDB: 

Position
X
AA seq 508 aa AA seqDB search
MDNCDQDASFRLSHIKEEVKPDISQLNDSNNSSFSPKAESPVPFMQAMSMVHVLPGSNSA
SSNNNSAGDAQMAQAPNSAGGSAAAAVQQQYPPNHPLSGSKHLCSICGDRASGKHYGVYS
CEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEERQR
GARNAAGRLSASGGGSSGPGSVGGSSSQGGGGGGGVSGGMGSGNGSDDFMTNSVSRDFSI
ERIIEAEQRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMP
HFAQVPLDDQVILLKAAWIELLIANVAWCSIVSLDDGGAGGGGGGLGHDGSFERRSPGLQ
PQQLFLNQSFSYHRNSAIKAGVSAIFDRILSELSVKMKRLNLDRRELSCLKAIILYNPDI
RGIKSRAEIEMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLFLFR
ITSDRPLEELFLEQLEAPPPPGLAMKLE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggacaactgcgaccaggacgccagctttcggctgagccacatcaaggaggaggtcaag
ccggacatctcgcagctgaacgacagcaacaacagcagcttttcgcccaaggccgagagt
cccgtgcccttcatgcaggccatgtccatggtccacgtgctgcccggctccaactccgcc
agctccaacaacaacagcgctggagatgcccaaatggcgcaggcgcccaattcggctgga
ggctctgccgccgctgcagtccagcagcagtatccgcctaaccatccgctgagcggcagc
aagcacctctgctctatttgcggggatcgggccagtggcaagcactacggcgtgtacagc
tgtgagggctgcaagggcttctttaaacgcacagtgcgcaaggatctcacatacgcttgc
agggagaaccgcaactgcatcatagacaagcggcagaggaaccgctgccagtactgccgc
taccagaagtgcctaacctgcggcatgaagcgcgaagcggtccaggaggagcgtcaacgc
ggcgcccgcaatgcggcgggtaggctcagcgccagcggaggcggcagtagcggtccaggt
tcggtaggcggatccagctctcaaggcggaggaggaggaggcggcgtttctggcggaatg
ggcagcggcaacggttctgatgacttcatgaccaatagcgtgtccagggatttctcgatc
gagcgcatcatagaggccgagcagcgagcggagacccaatgcggcgatcgtgcactgacg
ttcctgcgcgttggtccctattccacagtccagccggactacaagggtgccgtgtcggcc
ctgtgccaagtggtcaacaaacagctcttccagatggtcgaatacgcgcgcatgatgccg
cactttgcccaggtgccgctggacgaccaggtgattctgctgaaagccgcttggatcgag
ctgctcattgcgaacgtggcctggtgcagcatcgtttcgctggatgacggcggtgccggc
ggcgggggcggtggactaggccacgatggctcctttgagcgacgatcaccgggccttcag
ccccagcagctgttcctcaaccagagcttctcgtaccatcgcaacagtgcgatcaaagcc
ggtgtgtcagccatcttcgaccgcatattgtcggagctgagtgtaaagatgaagcggctg
aatctcgaccgacgcgagctgtcctgcttgaaggccatcatactgtacaacccggacata
cgcgggatcaagagccgggcggagatcgagatgtgccgcgagaaggtgtacgcttgcctg
gacgagcactgccgcctggaacatccgggcgacgatggacgctttgcgcaactgctgctg
cgtctgcccgctttgcgatcgatcagcctgaagtgccaggatcacctgttcctcttccgc
attaccagcgaccggccgctggaggagctctttctcgagcagctggaggcgccgccgcca
cccggcctggcgatgaaactggagtag

DBGET integrated database retrieval system