KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4381
Entry
Dmel_CG4381       CDS       T00030                                 
Symbol
GstD3
Name
(RefSeq) glutathione S transferase D3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG4381 (GstD3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG4381 (GstD3)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG4381 (GstD3)
   00983 Drug metabolism - other enzymes
    Dmel_CG4381 (GstD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG4381 (GstD3)
Enzymes [BR:dme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dmel_CG4381 (GstD3)
Transporters [BR:dme02000]
 Other transporters
  Pores ion channels [TC:1]
   Dmel_CG4381 (GstD3)
SSDB
Motif
Pfam: GST_N GST_C GST_C_2 GST_N_2 GST_N_3 GST_C_3 GST_C_6 DUF5424
Other DBs
NCBI-GeneID: 48336
NCBI-ProteinID: NP_788656
FlyBase: FBgn0010039
UniProt: Q9VG97
Position
3R
AA seq 199 aa
MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKY
GKDDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDF
LNTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEEN
WAGALDVKKRIEEKQNAAK
NT seq 600 nt   +upstreamnt  +downstreamnt
atggtgggcaaggccctgggtctagaatttaataagaagataatcaatacgctgaaaggg
gagcaaatgaatcccgatttcatcaagatcaacccgcagcactcgattcccacgctggta
gacaatggtttcaccatttgggagtcgcgtgccattctcgtttacctggtggaaaagtac
ggaaaggatgacgcgctgtaccccaaggatattcagaagcaggcggtgatcaatcaacgc
ctttacttcgacatggcgttgatgtatcccaccctggccaactactactacaaagcattt
accaccggtcagtttggcagcgaggaggactacaaaaaggtccaggagactttcgatttc
ctaaacacattcctggagggtcaggactacgtggctggggaccagtataccgtcgccgac
attgccattctcgccaatgtctccaatttcgatgttgtgggattcgacattagcaaatat
ccgaatgtggcccgatggtacgaccatgtcaagaagattacccctggatgggaagaaaac
tgggcaggagctctggatgtaaagaagaggatcgaggagaaacagaatgctgctaaataa

DBGET integrated database retrieval system