KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4421Help
Entry
Dmel_CG4421       CDS       T00030                                 

Gene name
GstD8
Definition
(RefSeq) glutathione S transferase D8
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG4421 (GstD8)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG4421 (GstD8)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG4421 (GstD8)
   00983 Drug metabolism - other enzymes
    Dmel_CG4421 (GstD8)
Enzymes [BR:dme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dmel_CG4421 (GstD8)
Transporters [BR:dme02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dmel_CG4421 (GstD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_C_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 48341
NCBI-ProteinID: NP_524916
FlyBase: FBgn0010044
UniProt: Q9VG92
Position
3R
AA seq 212 aa AA seqDB search
MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF
SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNH
PADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVA
RWYENAKEVTPGWEENWDGVQLIKKLVQERNE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacttttactaccatccttgctcggctccttgccgctccgttataatgacagccaag
gcccttggagttgacctgaatatgaagctattgaaggtcatggacggggagcaactgaag
ccggagtttgtgaagctcaatccacagcactgcattcccaccctggtggacgatggcttc
tccatctgggaatcccgtgccattttgatttacttggtggagaagtacggcgctgatgac
tcgctgtatcccagcgatccccagaagaaggctgtggtcaatcagaggctctacttcgac
atgggcaccctgtttcagagtttcgtcgaggccatctatccacagataaggaataatcat
cccgccgatccagaggccatgcagaaagtggacagcgcctttggccacctggacaccttc
ctggaggaccaggagtatgtggctggcgactgcctcaccattgccgacattgccctgttg
gcctccgtttccacctttgaggtggtggacttcgatatagcccagtatccaaatgtggcc
aggtggtacgagaatgccaaggaagtgactcccggttgggaagagaactgggacggtgta
cagctaatcaagaaacttgtccaggagaggaatgaatga

DBGET integrated database retrieval system