KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4429
Entry
Dmel_CG4429       CDS       T00030                                 

Gene name
eIF4H1
Definition
(RefSeq) eukaryotic translation initiation factor 4H1, isoform D
  KO
K24086  translation initiation factor 4H
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG4429 (eIF4H1)
   03012 Translation factors [BR:dme03012]
    Dmel_CG4429 (eIF4H1)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmel_CG4429 (eIF4H1)
Translation factors [BR:dme03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    Dmel_CG4429 (eIF4H1)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 49809
NCBI-ProteinID: NP_001285330
FlyBase: FBgn0262734
UniProt: X2JC79
Position
X
AA seq 388 aa
MAGRGGYEHARSGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLV
KDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGGGVGG
GNGGMTRGDGGRDGFQKRGPPRQGGSSQSYSRGGPGTGGGGREGGGGSGNRGDSRGSYID
SYGGHNDRSRGVGGSGAGSGGGMNRGYNDRPANRGRYGSFNNDDRPFERNQDRDRGQREG
SYGNQSRDGDRYNNFNRHRDRERTHYNPNQQSERPSGGMTGLGGGSGGSGGLGVGGGSSM
GAIDNFRHFKKPISRIISNMCQSRVSQLAVPRTNDNERPRLQLKPRTIAAPINAVAETKQ
SASIFGNAKPREEKLKELQQNVNHNGDN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggctggaagaggtggttatgaacacgctagaagcggattcggtggggatcgggcatcc
aagcagttgcccacggaaccgccgttcatcgcatttgtcggcaatttgccgcaaggcctt
gtgcagggcgatgtgatcaaaatattccaggactttgaggtgaagtacgtgcggctggtg
aaggaccgggaaacggatcagttcaaaggcttctgctacgtcgaattcgagacgctggac
aatctggagcgggcgctagagtgcgatggtcggatcaaactggacgatctgtcggcgccg
ctaaggatcgacattgccgatcggagaaaaaatgatcgccctggtggcggtgttggcggc
ggcaacggcggcatgacccgcggcgacggcggcagagacggtttccagaagcgcggccca
cctcgccagggcggcagcagtcagtcctacagccggggaggtcctggcactggcggcggc
ggtcgggagggcggcggcggttcgggtaatcgcggcgatagtagaggttcgtacattgat
agttatggtggtcacaatgatagaagtcgcggcgtcggcggcagcggcgcgggctccggc
ggtggcatgaatagaggatacaatgatcggccggcaaatcgtggtcggtacggcagtttc
aataacgacgatcgaccattcgagcgtaaccaggatcgggatcgcggtcagcgggaaggc
agctatggcaaccagtcgcgcgacggcgatcgctacaacaacttcaaccggcaccgcgac
cgcgagcgcacccactacaatcccaaccagcagagcgaacgtcccagtggcggcatgacc
ggccttggcggcggctccggcggatcaggaggcctaggcgttggcggtggttcctcaatg
ggcgccattgacaattttagacatttcaagaaaccgatttcaagaattatttcaaatatg
tgtcaatcgagagtatcacaattagccgtaccacgtactaacgacaatgagcggccacgt
ctgcagctgaagccacggaccattgccgcgcccattaacgcggtggcagagaccaagcaa
tcggcctcgatctttggcaacgccaagccgcgcgaagagaagctgaaggagctgcagcag
aatgtcaatcacaacggcgataactag

DBGET integrated database retrieval system