KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4494Help
Entry
Dmel_CG4494       CDS       T00030                                 

Gene name
smt3
Definition
(RefSeq) smt3, isoform B
  KO
K12160  small ubiquitin-related modifier
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dmel_CG4494 (smt3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG4494 (smt3)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG4494 (smt3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG4494 (smt3)
Ubiquitin system [BR:dme04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   Dmel_CG4494 (smt3)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    Dmel_CG4494 (smt3)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    Dmel_CG4494 (smt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 33981
NCBI-ProteinID: NP_001303312
FlyBase: FBgn0264922
UniProt: O97102
Structure
PDB: 

Position
2L
AA seq 90 aa AA seqDB search
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQ
PINENDTPTSLEMEEGDTIEVYQQQTGGAP
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaaaagaagggaggtgagaccgagcacatcaacctgaaggtcctcggccag
gacaacgccgtcgtccagttcaagatcaagaagcacacacccttgaggaagctgatgaac
gcctactgcgaccgtgccggactctccatgcaggtggtgcgcttccgtttcgacggacag
cccatcaacgagaacgacactccgacctcgctggagatggaggagggcgacaccatcgag
gtttaccagcagcagactggtggcgctccataa

DBGET integrated database retrieval system