KEGG   Drosophila melanogaster (fruit fly): Dmel_CG45051
Entry
Dmel_CG45051      CDS       T00030                                 

Gene name
sima
Definition
(RefSeq) similar, isoform A
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04137  Mitophagy - animal
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG45051 (sima)
   04137 Mitophagy - animal
    Dmel_CG45051 (sima)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG45051 (sima)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dmel_CG45051 (sima)
SSDB
Motif
Pfam: PAS_3 PAS PAS_9 PAS_4 SR-25
Other DBs
NCBI-GeneID: 43580
NCBI-ProteinID: NP_524584
FlyBase: FBgn0266411
UniProt: Q24167
Position
3R
AA seq 1507 aa
MVSLIDTIEAAAEKQKQSQAVVTNTSASSSSCSSSFSSSPPSSSVGSPSPGAPKTNLTAS
GKPKEKRRNNEKRKEKSRDAARCRRSKETEIFMELSAALPLKTDDVNQLDKASVMRITIA
FLKIREMLQFVPSLRDCNDDIKQDIETAEDQQEVKPKLEVGTEDWLNGAEARELLKQTMD
GFLLVLSHEGDITYVSENVVEYLGITKIDTLGQQIWEYSHQCDHAEIKEALSLKRELAQK
VKDEPQQNSGVSTHHRDLFVRLKCTLTSRGRSINIKSASYKVIHITGHLVVNAKGERLLM
AIGRPIPHPSNIEIPLGTSTFLTKHSLDMRFTYVDDKMHDLLGYSPKDLLDTSLFSCQHG
ADSERLMATFKSVLSKGQGETSRYRFLGKYGGYCWILSQATIVYDKLKPQSVVCVNYVIS
NLENKHEIYSLAQQTAASEQKEQHHQAAETEKEPEKAADPEIIAQETKETVNTPIHTSEL
QAKPLQLESEKAEKTIEETKTIATIPPVTATSTADQIKQLPESNPYKQILQAELLIKREN
HSPGPRTITAQLLSGSSSGLRPEEKRPKSVTASVLRPSPAPPLTPPPTAVLCKKTPLGVE
PNLPPTTTATAAIISSSNQQLQIAQQTQLQNPQQPAQDMSKGFCSLFADDGRGLTMLKEE
PDDLSHHLASTNCIQLDEMTPFSDMLVGLMGTCLLPEDINSLDSTTCSTTASGQHYQSPS
SSSTSAPSNTSSSNNSYANSPLSPLTPNSTATASNPSHQQQQQHHNQQQQQQQQQQHHPQ
HHDNSNSSSNIDPLFNYREESNDTSCSQHLHSPSITSKSPEDSSLPSLCSPNSLTQEDDF
SFEAFAMRAPYIPIDDDMPLLTETDLMWCPPEDLQTMVPKEIDAIQQQLQQLQQQHHQQY
AGNTGYQQQQQQPQLQQQHFSNSLCSSPASTVSSLSPSPVQQHHQQQQAAVFTSDSSELA
ALLCGSGNGTLSILAGSGVTVAEECNERLQQHQQQQQQTSGNEFRTFQQLQQELQLQEEQ
QQRQQQQQQQQQQQQQQQLLSLNIECKKEKYDVQMGGSLCHPMEDAFENDYSKDSANLDC
WDLIQMQVVDTEPVSPNAASPTPCKVSAIQLLQQQQQLQQQQQQQQNIILNAVPLITIQN
NKELMQQQQQQQQQQQQEQLQQPAIKLLNGASIAPVNTKATIRLVESKPPTTTQSRMAKV
NLVPQQQQHGNKRHLNSATGAGNPVESKRLKSGTLCLDVQSPQLLQQLIGKDPAQQQTQA
AKRAGSERWQLSAESKQQKQQQQQSNSVLKNLLVSGRDDDDSEAMIIDEDNSLVQPIPLG
KYGLPLHCHTSTSSVLRDYHNNPLISGTNFQLSPVFGGSDSSGGDGETGSVVSLDDSVPP
GLTACDTDASSDSGIDENSLMDGASGSPRKRLSSTSNSTNQAESAPPALDVETPVTQKSV
EEEFEGGGSGSNAPSRKTSISFLDSSNPLLHTPAMMDLVNDDYIMGEGGFEFSDNQLEQV
LGWPEIA
NT seq 4524 nt   +upstreamnt  +downstreamnt
atggtttcattaattgacacaatcgaagcggcggccgagaaacagaagcagtcccaagcg
gtggtcaccaacacctccgcctcctcctcctcctgttcctcttcgttctcgtcctcccca
ccatcttcgtccgttggctccccatctcctggcgccccaaaaaccaatctcacggccagc
ggcaaaccaaaggagaaaagaaggaacaatgaaaaacgcaaggaaaagtctcgcgatgcg
gctagatgtcgtcgctccaaggagacagagatattcatggaactctcggctgctttgcca
ttgaaaaccgacgatgtcaaccaactggacaaggcctccgtgatgaggatcaccatcgct
ttcctcaagattcgcgaaatgctgcagttcgtgcccagcttgcgcgactgcaatgatgac
atcaagcaggacattgaaactgcagaggatcagcaggaagtcaagcccaagctggaagtg
ggcactgaggattggctcaacggagctgaggccagagagctcctcaaacagaccatggac
ggattcctgttggtcttgtcccacgagggagacatcacctacgtgtccgaaaacgtagtc
gagtatctgggcatcaccaagattgacacacttggccaacagatctgggagtactcgcac
cagtgcgatcacgccgagatcaaggaggctctcagcctaaagcgtgaacttgcccagaag
gtcaaggatgagccgcagcagaactctggagtgagcacccatcaccgggatctgtttgtg
cgcttgaagtgcaccttgaccagtcgtggacgaagcatcaacatcaagagcgcttcgtat
aaggtcattcacatcacgggacacttggtggtcaatgcaaagggcgaacgtctgctgatg
gccattggccgaccaattccgcatccttcgaacattgagattccgttgggaactagcacc
ttccttaccaaacactccctggatatgcgtttcacctatgtggatgacaagatgcatgac
ttactgggatattcgcccaaggatctacttgacacctctttgttttcgtgccagcatgga
gcagattccgaacgcctgatggccaccttcaagagcgtgctgagcaagggacagggcgag
acctcccgctacagatttctgggaaaatacggtggctactgctggattcttagccaggcc
acgatcgtctacgataagttaaagccgcagagcgtcgtttgcgttaactatgtcataagt
aatcttgagaataaacatgagatatactcacttgctcaacaaacggcggcaagtgagcaa
aaggaacaacaccaccaagcagctgaaaccgagaaggagcccgaaaaagcagccgatccc
gaaataatcgctcaggaaaccaaggaaacagtaaacacacctattcacacctcagagctg
caagctaagccattgcaacttgagagcgagaaagcagagaaaaccatcgaggaaaccaaa
acaattgcaacaatcccaccagtaactgcaacctcaacggctgaccagataaagcagctg
cccgagagcaatccgtacaagcagatcctccaggcggagttgctcatcaagcgggagaac
cactcgccaggaccgcgcaccatcactgcccagctgctcagcggcagtagcagcggactg
cgtcccgaggagaagcgtcccaagtcggtgaccgcttcggtcctccgcccgagtccagct
ccacccctaacaccaccgcccacagcggtgctctgcaagaagactccgctcggcgtggag
cccaatctgccgccaaccaccaccgctacggcagccataatctcctcgagcaatcagcag
ctgcagatcgcacagcaaacccaactgcagaatccccagcaaccagctcaagatatgagt
aaaggattctgttcgctatttgccgacgatggacgaggtctgacaatgcttaaggaagaa
cctgacgatttgtcccaccacctggcctccaccaattgcattcagctggacgagatgact
cccttcagtgacatgttggttggcctcatgggcacctgcctgctgcccgaggatatcaat
tccctggactcgaccacctgctccacgacggccagcggccagcactaccagagccccagc
agcagcagcacctctgcacccagcaataccagtagcagcaataatagctatgccaacagt
ccgctcagcccgcttacacccaattccacggcaaccgctagcaatcccagtcatcagcag
caacagcaacatcacaaccagcagcagcagcagcaacaacagcagcagcatcatccccag
caccacgacaacagcaacagcagcagcaacatcgatccgctgttcaactatcgcgaggag
tcgaatgacacaagctgctcgcaacatctgcattcgcctagcatcacatcaaagagtccc
gaggacagcagcctcccatcgttgtgcagtcccaattcactaacacaggaggatgacttc
tctttcgaggcctttgccatgcgtgcgccctacatcccgatcgatgatgatatgcccctg
ctaacggagacggatctcatgtggtgcccaccagaggatctgcagaccatggtgcccaag
gagatcgacgccatacagcagcagttgcaacagttgcagcagcaacatcaccagcaatac
gccggcaacactggctaccagcagcagcagcagcagccgcaactccagcagcagcatttc
tccaactccctgtgctcctcgccagcttcaacggtctcgtcattgtcgccatcgcccgtg
caacagcatcatcagcagcaacaggcagcggtcttcaccagcgattccagcgaactggcg
gcattgctgtgcggatccggaaatggaacactttcgatcctggcaggtagtggtgttacg
gttgcggaggagtgcaacgagcggctgcagcaacatcagcagcagcaacagcagacgagt
ggcaacgagttcaggactttccagcagctgcagcaggagttgcagttgcaggaggaacag
cagcagcgtcagcagcagcaacaacagcagcaacagcagcagcagcaacagcagttactc
agcctaaatatcgagtgcaaaaaagagaaatacgatgtgcaaatgggaggcagtttatgt
catcccatggaggatgcatttgagaatgactacagcaaggattccgccaatctggactgc
tgggacctgattcaaatgcaggtggtggacacggaacccgtgagtcccaatgccgcatct
cccactccctgcaaggtgtctgccatccagttgctccagcaacagcagcaactgcagcag
cagcagcagcagcagcagaacattatcttgaatgcagtgccattgattaccatacagaat
aacaaggaattgatgcaacagcagcagcagcagcagcaacagcaacagcaggagcagctg
cagcagccggctataaaactgctgaatggagccagcattgcgccggtgaacaccaaggcc
accatccgcctggtggagagcaagccgcccaccacgacgcagtctcgaatggcgaaggtg
aacctcgtgccgcagcagcagcagcatggaaacaagcgccacctgaacagcgcgacagga
gcgggcaatcccgtggagtccaagcgtctgaagagcggaaccctctgcctggacgtgcag
tcccctcagctcctgcagcagctaattggcaaggatcctgcccagcagcaaacccaagca
gccaagcgagcaggcagtgagcgctggcaattgtcggcggagagtaaacagcagaagcag
caacaacagcagtcgaactcggtactaaagaacctgctggtcagcggacgcgatgatgac
gattccgaagcaatgataatcgatgaggacaactccctggtgcagccaattccactgggc
aaatatggcttgcccctgcactgtcatacctccacgtcttcggtgctgcgggactatcat
aacaacccgctgatcagtggcaccaacttccagctgtctccagtcttcggaggctccgat
tccagtggaggtgacggcgagactgggtcagtggtttccctagatgactcggtgccaccc
ggcttgacagcctgcgacacggatgcctccagcgacagtggcatcgatgagaacagcctg
atggatggggcatcggggtcaccgcgtaagaggttgtcctcaacttccaatagcactaat
caggctgagtcggcaccaccggctttggacgtggagactccagtgacccagaagtcggta
gaagaggagttcgagggaggcggaagcggcagtaacgcccccagcaggaagacttccatt
tccttcctggacagcagcaatcccctgctgcacacgccggcgatgatggacctggtcaac
gacgactacatcatgggcgagggtggcttcgagtttagcgacaaccagttggagcaagtc
ctgggttggccagaaatcgcctag

DBGET integrated database retrieval system