KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4533
Entry
Dmel_CG4533       CDS       T00030                                 
Symbol
l(2)efl
Name
(RefSeq) lethal (2) essential for life, isoform C
  KO
K09542  crystallin, alpha B
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04141  Protein processing in endoplasmic reticulum
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG4533 (l(2)efl)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG4533 (l(2)efl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG4533 (l(2)efl)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG4533 (l(2)efl)
Chaperones and folding catalysts [BR:dme03110]
 Heat shock proteins
  HSP20
   Dmel_CG4533 (l(2)efl)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG4533 (l(2)efl)
SSDB
Motif
Pfam: HSP20 Crystallin ArsA_HSP20
Other DBs
NCBI-GeneID: 37744
NCBI-ProteinID: NP_001261156
FlyBase: FBgn0011296
UniProt: P82147 A0A0B4KEY5
Position
2R
AA seq 187 aa
MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHT
NSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSR
QFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKEDNAK
KVETSTA
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtccgtagtgccactgatgttccgtgactggtgggatgagctcgactttccaatgcgc
acctcgcgcctcttggaccagcacttcggtcagggactgaagagggatgacctcatgtcc
tccgtgtggaactcccgccccacagtgctgcgatcgggatacctgcgcccctggcacacg
aacagcctgcagaagcaggagtccggttccaccctcaacatcgacagcgagaagttcgag
gtcattctggatgtgcagcagttctcgccatccgagatcaccgtcaaggtggccgacaag
ttcgtcatcgtggagggaaagcatgaggagaagcaggacgagcacggatatgtctcccgc
cagttctccagacgctaccagctgccaagtgatgtcaaccccgacacggtcacatcgtcc
ctctcctccgatggcctgctgaccatcaaggcgccaatgaaggcgctgcctcctccgcag
actgaacgccttgtgcagatcacacagactggtccctcctccaaggaggacaacgccaag
aaggtggagacctccaccgcctag

DBGET integrated database retrieval system