KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4574Help
Entry
Dmel_CG4574       CDS       T00030                                 

Gene name
Plc21C
Definition
(RefSeq) phospholipase C at 21C, isoform D
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00562  Inositol phosphate metabolism
dme01100  Metabolic pathways
dme04070  Phosphatidylinositol signaling system
dme04310  Wnt signaling pathway
dme04745  Phototransduction - fly
dme04933  AGE-RAGE signaling pathway in diabetic complications
Module
dme_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmel_CG4574 (Plc21C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4574 (Plc21C)
   04070 Phosphatidylinositol signaling system
    Dmel_CG4574 (Plc21C)
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Dmel_CG4574 (Plc21C)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG4574 (Plc21C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG4574 (Plc21C)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dmel_CG4574 (Plc21C)
Membrane trafficking [BR:dme04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Dmel_CG4574 (Plc21C)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Dmel_CG4574 (Plc21C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y EF-hand_like PLC-beta_C AAA_15 LVIVD PH_12
Motif
Other DBs
NCBI-GeneID: 33204
NCBI-ProteinID: NP_995605
FlyBase: FBgn0004611
UniProt: P25455
Position
2L
AA seq 1318 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIRWDDDSGTGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKRPKDNKLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCT
RRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRY
LMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNMDLPPPAMLRRKIIIKNKKKHHHHHHHHHHKK
PAQVGTPAANNKLTTANSVDAKAAQQVGLSASHEDGGVTRSTANGDVATGTGTGSAAGTA
GHAPPLQQIRQSSKDSTGSSDSDSSSEDESLPNTTPNLPSGNEPPPEKAQKETEAGAEIS
ALVNYVQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAG
TRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRR
LDPFAESTVDGIIAGTVSITVLSGQFLTDKRANTFVEVDMYGLPADTVRKKFRTKTVRDN
GMNPLYDEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIGLCPGYRHVNLRSEVG
QPIALASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQLSVLTDEAEALGSAD
EDLSKSFVFVQVGGQKKELRPVESLATSPKHRPSISAAAAMSVDVTVDRTDGGRGEDSIS
IVAPSIQHQHSLDQSVSTSIRQVESSQFDVDLVLAEPLEKILDHKSVKEKRLEMEKKLES
LRKKHDKEKIKIAGQKSSPLEGKKPKFAITNKLVKRLSNKSLNCLSPHSEPGVEIPACPL
DLGDSSEESAAADAGEDLAGGSSSLDGRTQESRLRSACREYTSQYRELQEKYHEAIYSAA
EKVLKTSQTGQTKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDELIRMKREVAS
SVVERGVAERVRLKQTFDRRTDELQKQHDSVRNALAEHRSKARQILDKEAESRSCVSSNG
FLVLFHGPHHHGCTGSGSSALSGNNLTLNLDAGAAGSHSAISPAKSHNSIAAAAEMKT
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgccggaggaacctacatctccaccgccagcgtggaggtgccacaagctctg
caagatggcgagaagttcattcgatgggatgatgactcgggcactggaacaccggttaca
atgcgcgtcgatgccaagggcttcttcctctactgggtcgaccagaacaacgagctggat
atccttgatatagccaccatacgcgacgttcgcacaggacagtacgctaagcgaccaaag
gacaacaagctgcgccagattgtgacgctgggcccccaggacacgctcgaggagaagaca
gtgacggtatgccacggctcggacttcgtcaacatgacgttcgtcaacttctgctgcacc
cggcgggacatagcccagctctggaccgacggactcatcaagttggcctacagcttggcc
cagctcaatggctcggcgattatgttcctgcagaaggcccataccaaactgtgtctccag
gtggacaaaagcggccgcataccagtgaaaaacatcataaaactttttgcccaaaacaag
gaggatcgcaaacgtgtcgagaaggcgctggacgtgaccggtttgccgtcgggaaaggtc
gatagcatatcggtgtccaaatttcaattcgaggacttttacaatttgtacaaatatctc
acgcagcgttcggaggtggaacgcctctttgacagcatcgttggcaactcgaagcgcaag
tgcatgtccatcgctcaactggtggagttcctgaacaagacacagcgtgatccccgcctg
aacgagatcctctacccttatgcgaatcccgcccgcgccaaggagctcatccagcaatat
gagcccaacaagttcaatgcgcaaaagggccaactcagcctggatggctttttgaggtac
ttaatgggcgacgacaatcccatcatggcgcccagcaagctcgatctctgcgatgacatg
gaccagccgatgtcgcactacttcatcaactcctcgcataacacctacttgacgggacac
cagctgaccggcaagtcgtccgtcgagatttacaggcagtgtctcctggcgggatgcaga
tgcgttgagctcgacttctggaacggacgcaccgaggagccagtcattgtccacggctat
acgttcgtgcccgagatatttgccaaggacgtgctggaggccatcgcagagagtgcattt
aaaacatccgaataccctgtgatattgagctttgagaatcactgcaaccctaggcaacag
gcgaaaattgccaactattgtcgcgaaatatttggcgatatgctgctcgataagcctctg
gactctcatccgctggagccgaacatggacttgccaccgccggcgatgctgcgccgcaag
attataatcaagaacaagaagaagcatcaccaccaccatcaccatcatcaccacaaaaag
ccagcgcaggtgggcacgccggcagccaacaacaaactgactacagcgaattcagtggat
gccaaggcggcgcaacaagtcggtttgtcggcctcgcatgaggatgggggcgtgaccagg
agcaccgccaacggtgacgttgccactggaacaggaaccggaagtgctgctgggacagca
ggacacgcgccgccgttgcaacaaatccgccaaagctccaaagacagcactggatcctcc
gattcggacagctcttcggaggatgaatccctgcctaacaccacgcccaatttgcccagc
ggcaacgaacctccgccagaaaaggctcaaaaggaaacggaggcgggagcagagatttca
gctttggtcaactatgttcagcccatccattttagctcttttgagaatgcggaaaaaaag
aatcgatgctacgaaatgtcttcgtttgatgaaaaacaggcgacaacattattgaaggag
cgaccgattgaatttgtgaactacaacaaacaccaattatctcgtgtctatccggcgggc
actcgctttgatagctccaactttatgccgcagttgttctggaatgccggatgtcagctc
gtggcacttaacttccaaaccctcgatctggccatgcaactcaacttggggatctttgag
tataacgctcggtccggttatctacttaagccggagtttatgcgccgatcagatcgcaga
ttggatcccttcgcggaaagcactgtggatggcatcatagcaggcacagtatcaatcacg
gttctatctggtcagtttctcacggataagagggcgaacacttttgtggaagttgatatg
tacggtttgccagcggacacggtgagaaagaagtttcgcaccaagacagtgcgggataat
ggaatgaatcccctttatgacgaggagccgttcgtgtttaagaaggtggttctccccgag
ttggcgagcattcgaattgcagcatatgaagagggtggcaaactcattggtcaccgcgtt
ttgcccgtaatcggtctttgccctggttaccgacatgtgaatctccgatctgaagtgggt
caaccaatagcccttgcctctcttttcctgtgcgtggtggtcaaggattatgtacccgat
gatctttccaatttcgcagaggcgctagctaaccctattaaataccaaagtgagctagag
aagcgcgatattcaactatctgttttgaccgacgaagccgaagcgctgggcagtgcggac
gaggatctctccaagtcgttcgttttcgtccaagtaggtggccaaaaaaaggagctgcgt
ccggttgaatcgcttgcgacttcgccgaagcataggccgagcatctcggccgccgcagca
atgagtgttgacgttaccgtggatcggaccgatggcggaaggggagaagatagcatctct
attgtagcaccctcaatacagcatcagcactctctagaccagtccgtaagcacctccatc
cgacaggtggagtcctcgcagtttgatgtcgatcttgtgttggcggagccgctggaaaag
atattggatcacaagtccgtcaaggaaaagcgtctcgagatggaaaagaagctggagtca
ctgcgaaagaagcatgacaaggaaaagattaagatcgccggccagaaatccagtccgcta
gagggcaagaagccgaagtttgccatcacgaataagctggtgaagcggctaagcaacaag
agtcttaattgtctttctccgcacagcgagcctggtgtagagatccccgcctgccctctg
gatctgggcgatagcagcgaggagagtgcagccgcggatgccggtgaggacttagccggt
gggagcagcagtctggatggcagaactcaagagtcgcgattacgcagtgcctgccgggag
tacacttcccagtaccgtgagctgcaggagaagtaccatgaggcaatttacagtgcagcc
gagaaggtgctgaagacatcgcaaactgggcaaacaaagcagttaaaagcatctctggac
aaggtcactggagaggttatgcaccagctgcaggaggcccgccgcaacgaggttaagaat
ctggccaccgtgcaccgggatcgtgatgagctgatcagaatgaaacgcgaggtggcaagc
tccgttgtggaacgtggcgtagctgaacgtgtgcggctgaagcagacctttgaccggaga
acggatgaacttcagaagcagcacgactcagtgcgcaatgccctggcagagcaccgctcc
aaggctcgtcaaattctcgacaaggaggcagaatcgcgaagctgtgtatccagcaatggc
ttcttggtcctcttccatggacctcatcaccatggctgtacgggctccggctcgtcagcc
ctttcaggcaataatctcactctaaatctggacgcgggggctgccggtagtcattcagcc
atttcgccggcaaagtcgcacaacagcatcgcagcagcggccgagatgaagacgtaa

DBGET integrated database retrieval system