KEGG   Drosophila melanogaster (fruit fly): Dmel_CG45760
Entry
Dmel_CG45760      CDS       T00030                                 

Definition
(RefSeq) JYalpha
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG45760
Enzymes [BR:dme01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     Dmel_CG45760
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG45760
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG45760
  Exosomal proteins of colorectal cancer cells
   Dmel_CG45760
  Exosomal proteins of bladder cancer cells
   Dmel_CG45760
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD InaF-motif
Other DBs
NCBI-GeneID: 5740846
NCBI-ProteinID: NP_001104092
FlyBase: FBgn0267363
UniProt: A8QI34
Position
4
AA seq 1009 aa
MPPKKKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLR
LEINGPNILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLY
LGIALTVLVIVTGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIV
EVKFGDRVPADIRILEAHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLE
GTCRGVVIATGDSTVMGRIANLAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISL
TLGYEFIDAVVFLIGIIVANVPEGLLVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTS
TICSDKTGTLTQNRMTVAHLWYDQIIVESDTTESFRGSHFKIEDKSFNALFMCAALCNSA
EFKGGQDDIPVFKKDVNGNASEAALLKFTETIFAGIGAFRQKHIKLTEIPFNSTEKYQVS
VHEFNSSDGYFIVEMKGAPERILDRCSTIIIQGLSVELTPTLKLEFEEAYLEMGGMGERV
LGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRAAVPDAVAKCRSAGVR
VIMVTGDHPITAKAIARSVGIITTPTAEDIAKQRGVTVLDIDSRQATAIVVHGGELREMK
AEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRADIGVAM
GISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFFV
IFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAY
LQIGVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVL
EYTAGTGFFVSIVVTQVFDLLICKTRRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVF
EKTLRMYSIKFIWWIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgccaccaaaaaaaaaaaataaggaacacaaaattaatggaaaagaaaagaaaaaagat
attcagtcttttaaaaaggatgtggaaactgacaatcataaaatacctgtagacgaactg
ttagagcgcttaaaaacagatcctaacatggggttgtcttttgttgaggccaagttaaga
ttggaaataaatggccctaacatacttaccccgcagcctccaacaccaaaatggatagtt
ttcttaaaaaccatgtttggtggattcgctatactactttgggcaggatcatttctttgt
ttcgtcggatatcttatacaattacaaacccagcacgaaccaccagatgacaatctctat
cttggcattgcattgaccgttttggtaatagtcactggattatttacttattttcaggtt
cataaatcgtcttctataatggattcatttaaaaaccttgttccacaatacgctacagtt
atacgagaaggggaaataaacacggttacttcagacgaaatagtaaaaggagatattgtg
gaagttaaatttggtgatagggtaccagctgacattcgaatattagaagctcatggactt
aaagtggataactcttccttgactggagagtccgagcctcaagtgaggtctacagaattt
acacatgaaaacccattggaaacaaagaacttggcttttttttctacaaacgtacttgaa
ggtacctgccgaggtgttgtcatagcaactggggacagtacagtaatgggacgtatagcg
aacttagctgcaggactggacgatgttcaatcacccatttcccgggaaatacaacttttt
attcggtttattacaatattcgcaataatactgggattatctttttttgcaataagttta
acattaggttatgaatttattgatgcagttgtgtttcttattggcattatagtcgcaaac
gtcccagaaggcttactcgtaactgtaaccgtatgtttaacccttactgcaaagcgtatg
gcatccaaaaattgtttggttaagaacttggaagctgtcgagactttaggttcgacatca
acaatttgttcagataaaaccggaaccctaacacaaaatcgaatgactgttgctcactta
tggtacgatcaaataattgttgaatctgacactactgaatcttttcgaggatcccatttt
aaaattgaggataaatcttttaatgctctttttatgtgtgccgcactttgcaattcagct
gaatttaaaggtgggcaagatgatatacccgtatttaaaaaagatgtcaatggcaacgca
tcagaggcagctcttttaaaattcaccgaaacaatttttgcaggtattggtgcttttcgc
caaaagcatataaaattgactgaaattccctttaattcaacggaaaagtatcaagtttct
gttcacgaatttaattcaagcgatggatactttatagttgagatgaaaggagctccagag
agaatattggatcgctgtagtacgataataattcaaggactgtctgtagaacttacacct
acattaaaattggaattcgaagaagcttatttggaaatgggcggtatgggtgaaagagta
ttgggatttgctgaccttctacttcccatgtctaaatatccaatttcctacgagttcagc
gcagatcctccaaattttccattagaaaatcttcgttttctgggactaatatcattaata
gacccgccaagagcagctgtcccagacgcagttgcaaaatgccgttcagcaggagtacgt
gtaattatggtaactggagatcaccccattacagctaaagccatagcccgcagtgttggc
attattacaacgcctactgcagaggacattgccaaacaacgtggcgttacagtactcgac
atcgattcccgacaagctactgctattgtggtccacggtggtgagcttcgggagatgaaa
gctgaagaattagacgcagtaatttactatcataatgaaattgttttcgcccgaacatct
ccacagcaaaaacttataatagtagaagcttgccagagacgtggtgaaattgttgctgtt
actggcgatggtgtgaatgactctccggcattaaaaagagccgatattggcgttgcaatg
ggtatttctggatctgacgtttctaagcaggcggcagatatgattctattggatgacaac
tttgcatcaattgttgttggtattgaagaggggcggattattttcgataatcttaaaaag
tccatcgcatataccttgacttcaaatcttcctgaaatagtgccgtttttattttttgtg
atatttgatatacctttagctctgggcactatagcaattctatgcatcgatatcggcact
gatatgcttccggcaatatcgctagcttatgaaaaagctgaatctgatataatggcgcgt
atgccaagagatccgtttgaagaccgtttggtaaataaaaagttaattctaatggcttat
ttgcaaattggagttatacaaacagtagcatgtttttttactttttttgctataatggca
gaacatggattccccccctccagacttaaaggaattcgagaagactgggactcaaaaaat
gtagaagaccttgaagatggctacggacaagaatggacctacagggaacgtaaagttctt
gaatatacagcaggcaccgggttttttgtgtcgattgttgtaacacaggtttttgacctt
ttaatatgcaaaactcgtcgaaactcaatattgcaacaaggtatgggcaatcatgtactt
aactttgctttggttcttgaattcatcattgcctgtctactttgctatgttccagtattt
gaaaaaacattgagaatgtattccatcaaatttatttggtggatatatgcgttccctttt
ggtctattaattttcttttttgatgaaagtcgtcgatttctaataagaagaaatccaggt
ggatgggtggaacaagaaacttattattaa

DBGET integrated database retrieval system