KEGG   Drosophila melanogaster (fruit fly): Dmel_CG46149Help
Entry
Dmel_CG46149      CDS       T00030                                 

Gene name
Fatp1
Definition
(RefSeq) fatty acid transport protein 1, isoform F
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dme01004]
    Dmel_CG46149 (Fatp1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG46149 (Fatp1)
Enzymes [BR:dme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Dmel_CG46149 (Fatp1)
Lipid biosynthesis proteins [BR:dme01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Dmel_CG46149 (Fatp1)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   Dmel_CG46149 (Fatp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF3952
Motif
Other DBs
NCBI-GeneID: 26067068
NCBI-ProteinID: NP_001162940
FlyBase: FBgn0267828
UniProt: E1JHE4
Position
2L
AA seq 746 aa AA seqDB search
MLFRKARRHFLPFYMFNGFLXQRNERYQRLRYNSSNIGHPRHELTHNSLLDNYANSNVII
NIDNCALYSTNRPADRKSITDGSHDRQRRRRQRFLVIFRFFCATVAFGLAIACVIYTLHT
MGWIFAVLVALVALLLTKPGWRWFYIAGATASRDLTALWAYIKLLRYTKRHERLNYTVAD
VFERNVQAHPDKVAVVSETQRWTFRQVNEHANKVANVLQAQGYKKGDVVALLLENRAEYV
ATWLGLSKIGVITPLINTNLRGPSLLHSITVAHCSALIYGEDFLEAVTDVAKDLPANLTL
FQFNNENNNSETEKNIPQAKNLNALLTTASYEKPNKTQVNHHDKLVYIYTSGTTGLPKAA
VISHSRYLFIAAGIHYTMGFQEEDIFYTPLPLYHTAGGIMCMGQSVLFGSTVSIRKKFSA
SNYFADCAKYNATIGQYIGEMARYILATKPSEYDQKHRVRLVFGNGLRPQIWPQFVQRFN
IAKVGEFYGATEGNANIMNHDNTVGAIGFVSRILPKIYPISIIRADPDTGEPIRDRNGLC
QLCAPNEPGVFIGKIVKGNPSREFLGYVDEKASAKKIVKDVFKHGDMAFISGDLLVADEK
GYLYFKDRTGDTFRWKGENVSTSEVEAQVSNVAGYKDTVVYGVTIPHTEGRAGMAAIYDP
ERELDLDVFAASLAKVLPAYARPQIIRLLTKVDLTGTFKLRKVDLQKEGYDPNAIKDALY
YQTSKGRYELLTPQVYDQVQRNEIRF
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcgcaaggctcgccgacactttctgccgttctacatgttcaatggattcttg
tgacagcgcaacgaacgatatcagcgtttgcgttacaatagctcaaatattggtcatccg
aggcatgagcttacacacaacagcctgttggacaactatgcgaacagcaatgtgataata
aacattgacaactgcgcgctctacagcaccaatcggccagctgatcgaaagtcgataacc
gacggctcgcacgatcgacagcgacgtcgccgccagcggtttttagtcatttttcggttt
ttctgcgcaacggtcgctttcggtttggcaatcgcctgcgtcatctacacgctccacaca
atgggctggatttttgctgtgctcgtcgcactggtggctctgctactgacgaaacccggc
tggcgctggttctacatagcgggtgcgaccgctagtcgcgatctaacagctctctgggcc
tatatcaagctgctgaggtacacgaagcgccatgagcggctcaactacacggtggcggac
gtcttcgaacgaaatgttcaggcccatccggacaaggtggctgtggtcagtgagacgcaa
cgctggaccttccgtcaggtgaacgagcatgcgaacaaggtggccaatgtgctgcaggct
cagggctacaaaaagggcgatgtggtggccctgttgctggagaaccgcgccgagtacgtg
gccacctggctgggtctctccaagatcggtgtgatcacaccgctgatcaacacgaatctg
cgcggtccctccctgctgcacagcatcacggtggcccattgctcggctctcatttacggc
gaggacttcctggaagctgtcaccgacgtggccaaggatctgccagcgaacctcacactc
ttccagttcaacaacgagaacaacaacagcgagacggaaaagaacataccgcaggccaag
aatctgaacgcgctgctgaccacggccagctatgagaagcctaacaagacgcaggttaac
caccacgacaagctggtctacatctacacctccggcaccacaggattgccaaaggctgcg
gttatctctcactcccgttatctgtttatcgctgctggcatccactacaccatgggtttc
caggaggaggacatcttctacacgcccttgcctttgtaccacaccgctggtggcattatg
tgcatgggtcagtcggtgctctttggctccacggtctccattcgcaagaagttctcggca
tccaactatttcgccgactgcgccaagtataatgcaactattggtcagtatatcggtgag
atggctcgctacattctagctacgaaaccctcggaatacgaccagaaacaccgagtgcgt
ctggtctttggaaacggactgcgaccgcagatttggccacagtttgtgcagcgcttcaac
attgccaaggttggcgagttctacggcgccaccgagggtaatgcgaacatcatgaatcat
gacaacacggtgggcgccatcggctttgtgtcgcgcatcctgcccaagatctacccaatc
tcgatcattcgcgccgatccggacaccggagagcccattagagataggaatggcctatgc
caactgtgcgctcccaacgagccaggcgtattcatcggcaagatcgtcaaaggaaatcct
tctcgcgaattcctcggatacgtcgatgaaaaggcctccgcgaagaagattgttaaggat
gtgttcaagcatggcgatatggctttcatctccggagatctgctggttgccgacgagaag
ggttatctgtacttcaaggatcgcaccggtgacaccttccgctggaagggcgagaatgtt
tccaccagcgaggtggaggcgcaagtcagcaatgtggccggttacaaggataccgtcgtt
tacggcgtaaccattccgcacaccgagggaagggccggcatggccgccatctatgatccg
gagcgagaattggacctcgacgtcttcgccgctagcttggccaaggtgctgcccgcgtac
gctcgtccccagatcattcgattgctcaccaaggtggacctgactggaacctttaagctg
cgcaaggtagacctgcagaaggagggctacgatccgaacgcgatcaaggacgcgctgtac
taccagacttccaagggtcggtacgagctgctcacgccccaggtttacgaccaggtgcag
cgcaacgaaatccgcttctaa

DBGET integrated database retrieval system