KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4742Help
Entry
Dmel_CG4742       CDS       T00030                                 

Gene name
mRpL22
Definition
(RefSeq) mitochondrial ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dmel_CG4742 (mRpL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dme03011]
    Dmel_CG4742 (mRpL22)
Ribosome [BR:dme03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dmel_CG4742 (mRpL22)
  Bacteria
    Dmel_CG4742 (mRpL22)
  Archaea
    Dmel_CG4742 (mRpL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 32662
NCBI-ProteinID: NP_523379
FlyBase: FBgn0030786
UniProt: Q9VXB5
Position
X
AA seq 233 aa AA seqDB search
MHKVIRQMSQLRLQAPQGAALLRSADSSSISPAISPVSPPALQSKSLHTAASAGMLCAKW
NKYNYGPRKWLEYNKTVHPPQETDEEPRNAYVCHMRSNIKYSPDKMWYIAAFVRGMSVDE
ALKQLNFVLKKGATDVKETILEAQQIAVERHNVEYKSNLWIAESFVGKGRVFKGVRRHAR
GRFGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYESWMEQMRSRKIINSL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggtgatccggcaaatgtcccagctgcgcctgcaggcgccacagggagcagcg
ctcctccgatcggcggatagcagctcaatatcaccagccatatcaccagtttcaccacct
gccctccagtcgaaatccctgcacacggccgcttccgccggaatgctgtgcgccaagtgg
aacaagtacaactacggaccccgcaaatggctggagtacaacaagaccgtgcatccgccg
caggaaacggacgaggagcccagaaatgcttatgtctgccacatgcgcagcaacatcaaa
tacagtccggacaagatgtggtacatcgctgcctttgttcgcggaatgtccgtcgacgag
gcgctgaagcagctgaactttgtgctcaaaaagggggccaccgatgtgaaggagaccata
ctggaggcccagcaaatagccgtggagcggcataacgtggagtacaagagcaatctgtgg
atagccgaatccttcgtgggcaagggacgcgtcttcaagggcgtgaggcggcatgctcgc
ggtcgcttcggcaaagtggagtacaagcactgccactacttcgtgcgcctggaggagggc
gagccgccgcagcactactaccaggagccgcagacgccggagcagcagtacgagagctgg
atggagcagatgcgaagccggaagatcatcaactcgctgtag

DBGET integrated database retrieval system