KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4761
Entry
Dmel_CG4761       CDS       T00030                                 

Symbol
knrl
Name
(RefSeq) knirps-like, isoform B
  KO
K08706  nuclear receptor subfamily 0 group A
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG4761 (knrl)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dme03310]
    Dmel_CG4761 (knrl)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    Dmel_CG4761 (knrl)
Nuclear receptors [BR:dme03310]
 0. Knirps / DAX like
  0A. Knirps like receptor
   Dmel_CG4761 (knrl)
SSDB
Motif
Pfam: zf-C4
Other DBs
NCBI-GeneID: 40285
NCBI-ProteinID: NP_001303368
FlyBase: FBgn0001323
UniProt: P13054 A0A0S0WNG8
Position
3L
AA seq 647 aa
MMNQDNPYAMNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKNNGECIIN
KKNRTACKACRLKKCLMVGMSKSGSRYGRRSNWFKIHCLLQEQQQQAVAAMAAHHNSQQA
GGGSSGGSGGGQGMPNGVKGMSGVPPPAAAAAALGMLGHPGGYPGLYAVANAGGSSRSKE
ELMMLGLDGSVEYGSHKHPVVASPSVSSPDSHNSDSSVEVSSVRGNPLLHLGGKSNSGGS
SSGADGSHSGGGGGGGGGVTPGRPPQMRKDLSPFLPLPFPGLASMPVMPPPAFLPPSHLL
FPGYHPALYSHHQGLLKPTPEQQQAAVAAAAVQHLFNSSGAGQRFAPGTSPFANHQQHHK
EEDQPAPARSPSTHANNNHLLTNGGAADELTKRFYLDAVLKSQQQSPPPTTKLPPHSKQD
YSISALVTPNSESGRERVKSRQNEEDDEARADGIIDGAEHDDEEEDLVVSMTPPHSPAQQ
EERTPAGEDPRPSPGQDNPIDLSMKTTGSSLSSKSSSPEIEPETEISSDVEKNDTDDDDE
DLKVTPEEEISVRETADPEIEEDHSSTTETAKTSIENTHNNNNSISNNNNNNNNNNNSIL
SDSEASETIKRKLDELIEASSENGKRLRLEAPVKVATSNALDLTTKV
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgatgaatcaggataatccatatgcgatgaatcagacgtgcaaggtgtgtggagagccg
gcggctggattccatttcggagcctttacatgcgagggctgcaagtccttcttcggccga
tcgtacaacaatctgtcgtcgatatccgactgcaagaacaacggcgagtgcatcatcaac
aagaagaaccgaaccgcctgcaaggcgtgccgtctgaagaagtgcctcatggtgggcatg
tcgaagagtggatcccgatatggtcgtcgctccaactggttcaagatccactgtctgctg
caggagcagcagcagcaggcggtggctgcgatggcggcgcaccacaatagccagcaggcg
ggtggtggaagttccggtggatcgggcggtggtcaaggaatgcccaacggggtcaagggc
atgtcgggtgtacccccaccggcggctgcagcagctgctctgggaatgctcgggcatcct
ggtggttatccgggtctgtatgccgttgccaatgctggcggctcgtcacggagtaaagag
gagctaatgatgttgggattggatggcagcgtggagtacggctcccataaacatccggtg
gtggcatcaccctccgtaagttccccggattcccacaactccgacagctctgtggaggtg
agttcggtgcgaggcaacccactcctacacttgggcggaaaatccaattcgggaggatct
tcaagtggtgccgatggcagtcattcgggaggaggaggaggaggaggaggaggagtgacg
cccggcagaccgccacagatgcgcaaggatttgtcgccattcctgccgctgcccttccca
ggcctagcatcaatgcccgtgatgccaccacccgcgttcctgcctccctcgcacctactc
ttccccggctaccaccccgccctgtactcgcaccaccagggcttgctgaagccaacgcca
gagcaacaacaggcagcggtggctgcggcggccgtgcaacatctattcaactccagtggt
gcaggccagcgtttcgcaccgggcacttcaccatttgccaaccaccagcagcaccacaag
gaagaggatcagccagcaccagccagaagtccaagtacccatgcgaacaacaaccacctg
ctaacgaatggtggtgctgccgatgagctaaccaaacgcttctatttagacgctgtgctc
aagtcccagcaacaaagtcctccgccgaccaccaaactaccgccacactccaagcaggat
tactcaatttcagctctggtcacaccaaactcggaaagtggcagggagagagtgaaaagt
cgccagaacgaagaggacgacgaggcgagagcggatggaattattgatggcgccgagcac
gacgatgaggaggaggatctggtggtgtccatgacgccaccccactcacccgctcaacaa
gaagagcgaaccccagccggcgaggatcccagacccagtcccggtcaagataatcccatt
gatctgagcatgaagaccaccggcagttccctgagcagtaaaagtagtagcccagaaatc
gaaccagaaaccgagatctctagcgatgtagaaaagaacgatacagatgatgacgatgag
gatctgaaagtaacgcctgaagaggagatatcagttcgagaaacggctgatccggagata
gaggaagatcactccagcaccacagagacagcaaagaccagcattgaaaatacccacaat
aacaacaacagtatcagcaacaacaataacaataataataataataataatagtatccta
agcgatagcgaggccagtgaaacgatcaagaggaaactggacgaactcatagaggccagc
agtgagaatggaaaacgtctgaggttggaagcccccgtcaaagtggccacctcgaatgcc
ttggatctaaccactaaggtctga

DBGET integrated database retrieval system