KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4799
Entry
Dmel_CG4799       CDS       T00030                                 

Gene name
Pen
Definition
(RefSeq) pendulin
  KO
K15043  importin subunit alpha-1/8
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG4799 (Pen)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dmel_CG4799 (Pen)
SSDB
Motif
Pfam: Arm Arm_3 IBB HEAT_EZ HEAT_2 HEAT V-ATPase_H_C Adaptin_N
Other DBs
NCBI-GeneID: 34338
NCBI-ProteinID: NP_477041
FlyBase: FBgn0267727
UniProt: P52295
Position
2L
AA seq 522 aa
MSKADSNSRQGSYKANSINTQDSRMRRHEVTIELRKSKKEDQMFKRRNINDEDLTSPLKE
LNGQSPVQLSVDEIVAAMNSEDQERQFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRF
LQNTNNSMLQFEAAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALG
NIAGDGAAARDIVIHHNVIDGILPLINNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKR
LLPVLSQLLLSQDIQVLADACWALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIV
PALRSVGNIVTGTDQQTDVVIASGGLPRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQ
AVIQAGIFQQLRTVLEKGDFKAQKEAAWAVTNTTTSGTPEQIVDLIEKYKILKPFIDLLD
TKDPRTIKVVQTGLSNLFALAEKLGGTENLCLMVEEMGGLDKLETLQQHENEEVYKKAYA
IIDTYFSNGDDEAEQELAPQEVNGALEFNATQPKAPEGGYTF
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtaaggcggattctaactcacgacagggctcctacaaggccaacagcattaacacg
caggactcacgcatgcgccgccatgaggtgaccatcgagctgcgcaagtccaaaaaggag
gaccagatgttcaagcggcgcaacatcaacgacgaggatctaacgtcgccgctcaaagag
ctcaatggccagtcgccggtgcagctgtccgtggacgagatagtggcggccatgaacagc
gaggatcaggagcgccagtttctgggcatgcagtctgcccgcaagatgctcagtcgggag
cgcaatccacccatcgacctgatgatcggccatggtattgtgcccatttgcatacgcttc
ctgcagaataccaacaactcaatgctgcagttcgaggccgcttgggcgcttaccaacatc
gcctctggcacatccgaccaaacgcgctgcgttatcgaacacaatgctgtgccgcatttc
gtggctctgctccagtccaagtccatgaacctggccgagcaggcagtctgggctctgggc
aacattgccggcgacggagccgccgcccgcgacattgtcatccaccacaacgtaattgac
ggaatcttgccactgatcaacaatgagacaccgctctcttttctgcgcaacatcgtctgg
ctgatgtccaacctgtgccggaacaagaatccatcgccgccattcgatcaggtgaagcgg
ctgttgcccgtcctgtcgcagcttctgcttagtcaggacatccaagtgctggccgacgcc
tgctgggctttgtcctacgtcacggacgacgataacaccaagatccaggctgtggtcgac
tcggacgcagtgccgcgcctggtcaaactgctgcaaatggacgagccgagcattattgtg
cccgccctgcgcagcgttggcaacattgtgactggcacagatcaacagactgacgttgta
attgcatctggaggtttaccaaggctgggactccttctacagcacaacaaaagcaacatt
gtgaaggaggctgcctggacggtcagcaacatcacagcaggtaaccagaagcagatccag
gctgtgattcaggccggcatcttccagcagctgcgcaccgtgctggagaagggtgatttc
aaggctcaaaaagaggctgcctgggcggtgacaaacaccacgacatctggcactcccgaa
cagatcgtcgatctaattgagaagtacaaaatattgaagccttttatcgatttgctggac
acaaaggatccgcgtaccatcaaggtggtgcagacgggcctatccaatctgtttgccctg
gcggagaaacttggtggcaccgagaacctatgcttgatggtcgaggagatgggcggtcta
gacaagctggaaactctgcagcagcacgagaacgaggaggtctacaagaaggcctacgcc
atcattgacacatacttcagcaacggcgacgacgaggccgagcaagagctcgcacctcag
gaggtcaacggagccctcgagttcaatgccacccagcccaaggctcccgaaggtggctac
acgttctaa

DBGET integrated database retrieval system