KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4860Help
Entry
Dmel_CG4860       CDS       T00030                                 

Gene name
CG4860
Definition
(RefSeq) uncharacterized protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00071  Fatty acid degradation
dme00280  Valine, leucine and isoleucine degradation
dme00410  beta-Alanine metabolism
dme00640  Propanoate metabolism
dme00650  Butanoate metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
dme01212  Fatty acid metabolism
Module
dme_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Dmel_CG4860 (CG4860)
   00650 Butanoate metabolism
    Dmel_CG4860 (CG4860)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dmel_CG4860 (CG4860)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmel_CG4860 (CG4860)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dmel_CG4860 (CG4860)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Dmel_CG4860 (CG4860)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Ald_Xan_dh_C F_actin_bind
Motif
Other DBs
NCBI-GeneID: 41480
NCBI-ProteinID: NP_650163
FlyBase: FBgn0037999
UniProt: Q9VGC2
Position
3R
AA seq 415 aa AA seqDB search
MQQLIRVARTLGQRSSGAWSARIIAGGNRGIACLAALSETHQILQKTCREFANAELAPKA
RHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMG
VNNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQ
INGTKAWISNSKEASGGIVFATVDKSMKHKGITAFLTPKDVPGLSIAKKESKMGMRATST
CQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALELAVDYSQKRV
AFGKHLARLQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLHASESATF
CAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIANAVLRELGKE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagctgatcagagtggcgcggacgttgggtcaacgctcgagcggcgcatggagt
gcgaggataatcgctggtggaaaccggggaatcgcatgcctggccgccctctccgagacc
caccagattctccagaagacttgccgggagttcgccaatgcggaactggcccccaaagcg
cgacaccacgaccgggaggagctttatccggcggaacaggtccgacggttgggagaactc
ggtctcatgtcagtgacggttcgagaggagtatggtggttccggattggattaccaggcc
tacgcgattggcatggaggaggtggctcgtggtgacgccgccgtgtccattgtgatgggc
gtgaataacctgtacctgggtgcagtgcagcagcatggaaccgagcagcagaagcaggat
ttcctggtgccgtacacccagggtgagcacatcgccttctatgcactatcggaacctgga
aacggatcggatgcaggagctgccagcaccacggccaagctgcaaggggacagctaccaa
ataaacggcactaaagcgtggatatcaaactccaaggaggccagcgggggtatcgtcttt
gccacggtggacaagagcatgaaacacaagggaatcactgcctttcttacgcccaaggat
gttccaggactctccatagccaagaaggaaagcaaaatgggcatgcgcgcgacttcgact
tgccagctggtgctggaggacgttcacgtgccgcgatcccgggtccttggagctgccggt
gatggcttcaagatcgccatgcagtccttggactgtggcaggatcggtatagccgcccag
gccaccggtatcgcacaagctgccctggaactagccgtggattattcgcagaagagggtg
gccttcggaaagcatctggcacggttgcagctcatccagcagaagctggccgacatggcc
acgcgggtggagatctcaaggctgctaacgtggcgtgccgcttggctgaaggataatggg
ctgccaatcacaaaggaggcggccatggccaagctgcatgcctccgagtccgccaccttt
tgtgcccaccagtgcatccagatcctgggtgggatggggtacaccaccgatctgcctgcg
gagctttactaccgcaacgcccgcgtcacagagatttacgagggaacctcggagatccaa
agaattgtgatcgccaacgcagtgctgcgggaattgggaaaggagtga

DBGET integrated database retrieval system