KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4934Help
Entry
Dmel_CG4934       CDS       T00030                                 

Gene name
brn
Definition
(RefSeq) brainiac
  KO
K02175  putative enzyme (brainiac)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG4934 (brn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 31358
NCBI-ProteinID: NP_476901
FlyBase: FBgn0000221
UniProt: Q24157
Position
X
AA seq 325 aa AA seqDB search
MQSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKF
AYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGT
AEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYV
SAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAF
ILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSYSSV
IASHEFGDPEEMTRVWNECRSANYA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtaaacaccgcaaactgctgctgcgctgcctcctggtgctgcccctcatcctt
ctggtggactattgcggcctgctgacccacctgcacgagctgaacttcgagcggcacttt
cactacccgctgaacgatgacactggatctgggtccgcatcctctggactggacaagttc
gcctacctgcgagtgccctcgttcacggcagaggtgccggttgaccagcctgcgcggctc
acgatgctcataaagagcgcggtgggcaattcgcgacgtcgggaggccattcgccggact
tggggctacgagggtcgattctcagacgtccatctgcgtcgcgtgttcctgctgggcacg
gccgaggatagtgagaaagacgtggcttgggagtcccgcgagcatggcgacattctgcag
gcggagttcacggacgcctacttcaacaacacgctgaaaaccatgctgggtatgcgctgg
gctagcgatcagttcaatcgcagcgagttctatcttttcgtggacgacgactactatgtt
tcggccaagaacgtgctcaagtttctgggcagggggcgtcagagccaccagccggagttg
ctgttcgccgggcacgtgtttcagacatccccgctccgccacaagttcagcaagtggtac
gtttcgttggaggaataccccttcgatcggtggccaccgtacgtgaccgccggcgcgttc
attctgtcgcagaaggcactgcgccagctgtatgccgccagcgttcacctgccgctcttc
cggttcgacgacgtctacctgggcatagtggccttgaaagcgggcatttcccttcagcac
tgcgacgacttccgcttccatcggccggcgtacaaaggtccggacagctatagttcggtg
atagcctcgcacgaattcggcgatcccgaggagatgacgcgggtatggaacgagtgccga
tccgccaattacgcgtag

DBGET integrated database retrieval system