KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4965
Entry
Dmel_CG4965       CDS       T00030                                 

Gene name
twe
Definition
(RefSeq) twine, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 34954
NCBI-ProteinID: NP_001260491
FlyBase: FBgn0002673
UniProt: Q03019 M9PBC2
Position
2L
AA seq 426 aa
MASKRLMLDVEEEDDESGACGQENFDPHDADMEYQAKRRKSAVQETPLQWMLKRHIPAST
TVLSPITELSQNMNGARLDGTPKSTQRIPANRTLNNFNSLSSRTLGSFSSSCSSYESGNS
LDDEYMDMFEMESAENHNLELPDDLEVLLSGQLKSESNLEEMSNKKGSLRRCLSMYPSEQ
PEEAVQEPDQETNMPMKKMQRKTLSMNDAEIMRALGDEPELIGDLSKPCTLPCLATGIRH
RDLKTISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEA
FPTLTSNQENRRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYK
EFFGLYSQLCQPSQYVPMLAPAHNDEFRYFRAKTKSWQCGEGGDSGIGGGGSRGLRKSRS
RLLYAE
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgagcaagcggctaatgctcgatgtggaggaagaagatgatgaaagtggagcgtgt
ggtcaggagaatttcgatccccatgatgccgatatggaataccaggccaaaaggcgaaaa
tcagccgtgcaggagactccgctgcaatggatgctgaagcggcatattcctgccagcacc
accgttctgtcgcccatcaccgaattgtcgcagaatatgaatggagcccgcctggatggc
actcccaagtccacccagagaatcccagccaacaggaccctgaataactttaatagcctg
tcctcgcgaacactcggcagtttcagtagctcctgctcgagttacgagtcgggcaactcg
ctggatgatgagtacatggacatgttcgaaatggaatcagccgagaatcacaatcttgag
ttgcccgatgacttggaagtgctcctcagcggacagctgaaatcggaaagcaatttagag
gagatgtccaacaaaaaaggctccctgcgtcgctgccttagcatgtatcccagtgaacag
ccagaggaagcggttcaagaaccagatcaggagaccaacatgcccatgaagaagatgcaa
cggaaaactctatcaatgaacgacgccgagatcatgagagcactgggagatgaaccagag
ttaatcggagatctcagcaagccatgtaccctgccctgtttggcgacaggcattagacat
cgtgatctaaagaccatctccagtgacacattggccagactgattcagggcgagtttgat
gaacaattgggaagccagggcggatacgagatcatagactgccgttacccatacgagttc
cttggcggacacatacggggagcgaagaatttgtacacacgtgggcagatacaggaggcg
tttcccacgctgacctccaatcaggaaaatcgacgcatctacgtcttccactgtgagttc
tcctcggaacggggtcccaagctattgcgctacctgcggagcaacgacagaagtcagcat
acccacaactatccggcactggactatcctgaactttatatcctgcacaatgggtacaag
gagttcttcggtctatactcgcagctatgccagcccagccaatatgtaccaatgctggca
ccggcgcacaatgatgagtttcgatattttcgggccaagaccaagtcctggcaatgtggc
gagggcggagacagtggaatcggcggtggaggctctcgcggcctccggaaatcacgttca
cgactgctctacgccgagtga

DBGET integrated database retrieval system