KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4974Help
Entry
Dmel_CG4974       CDS       T00030                                 

Gene name
dally
Definition
(RefSeq) division abnormally delayed, isoform B
  KO
K02306  dally
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4974 (dally)
   04391 Hippo signaling pathway - fly
    Dmel_CG4974 (dally)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:dme00535]
    Dmel_CG4974 (dally)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
    Dmel_CG4974 (dally)
Proteoglycans [BR:dme00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   Dmel_CG4974 (dally)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
 Others
  Dmel_CG4974 (dally)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican Fz
Motif
Other DBs
NCBI-GeneID: 39013
NCBI-ProteinID: NP_001246685
FlyBase: FBgn0263930
UniProt: Q24114 Q53XG2
Position
3L
AA seq 626 aa AA seqDB search
MAARSVRLAQLLLFTLLCGFVGLSAAKHLDLDGIHHHQHHLHSATTHHRRRLQRDSRAKD
AVGGSTHQCDAVKSYFESIDIKSSGTYSEKGAICGGNCCNNATELELRDKAAGMFEQLLH
HHTSSLRGVLETNAKQFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMN
HLIYTSNYTNSNGQLGRRGIGSVQSNLEEAVRHFFVQLFPVAYHQMVHLSKNNLGDLHED
YVNCLQHNFDEMHPFGDIPQQVQSNLGKSVHMSNVFMNALLQAAEVLSEADALYGEQLTD
TCKLHLLKMHYCPNCNGHHSSSRSETKLCYGYCKNVMRGCSAEYAGLLDSPWSGVVDSLN
NLVTTHILSDTGIINVIKHLQTYFSEAIMAAMHNGPELEKKVKKTCGTPSLTPYSSGEPD
ARPPPHKNNVKWATDPDPGMVLFLSTIDKSKEFYTTIVDNFCDEQQHSRDDHSCWSGDRF
GDYTQLLINPGTDSQRYNPEVPFNAKAQTGKLNELVDKLFKIRKSIGAAAPSNSIQATHD
IQNDMGEGSGGGEGQIGDDEEEYGGAHGSGDGSGDGPHTPIEESEGTTTNEVESRDSGKT
SGSNPLEGTATWMLLTLVTMLFSSCS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaggagcgtgcggctagcgcagcttttgctatttaccctgctctgcggcttc
gtcggcctgtcagccgccaagcacctggacctggatggtatccaccaccaccagcaccac
ctgcacagcgccaccacgcaccacagacgtcgcctacagcgggactcgcgggcgaaggac
gccgttgggggatcgacccaccagtgtgatgccgtcaagagctacttcgaatcgatcgac
atcaagtcgagtgggacttacagcgaaaaaggcgccatttgtggcggaaactgctgcaac
aatgccacggagctggagctgcgggacaaagccgccggaatgttcgagcaactgcttcat
catcacaccagcagcctgcgcggagtcctcgagacgaatgccaaacagttccaaagtcac
gtcctggaattggcgcagatttcggagaacatgacccactcgctcttttcgaaggtttat
acccgtatggtgccttcatcgcgtatgatgatccatcaactgtacaccgaaatcatgaac
catctgatttacacctccaactatacgaacagcaatggccaactgggcaggcgaggaatt
ggcagtgtccagagcaacttggaggaggctgtcaggcacttctttgttcagttgttcccc
gtggcctaccaccagatggtccatctgtccaagaacaatttgggtgacttgcacgaggac
tacgttaactgcctgcagcacaacttcgacgagatgcatccattcggggacattccccag
caagtgcagtccaacttgggcaagagtgtccatatgtccaatgtcttcatgaatgccctg
ctccaggccgccgaggtcctcagcgaagcggatgccctttatggcgaacaactgacggac
acgtgcaaactgcatctcctcaagatgcactactgccccaactgcaatggacaccattca
agttctaggagcgaaacgaaattgtgctacggctactgcaagaacgtaatgcgcggctgt
tcggcggaatatgccggactactggacagtccctggtcaggtgtagtcgactccctgaac
aatctggtcaccacccatattctctcggacaccggcatcattaatgtcatcaaacacctg
cagacttatttctctgaggcaatcatggctgccatgcacaatgggcctgaactggaaaaa
aaggtaaagaagacatgtggcacgcccagcctgacgccctattcgtccggagaaccggat
gcgcggcctccgccccacaagaacaacgtaaagtgggccactgacccggatccgggcatg
gtcctcttcctgtccaccatcgacaagagcaaggagttctacacgaccatcgtggacaac
ttctgcgatgagcaacagcactctcgtgacgatcactcctgctggtcaggcgatcgtttc
ggggactacactcagctgctgattaatccgggcactgatagccagcgatataatcccgag
gtgcccttcaatgcgaaggctcagaccggcaagctgaacgagctggtcgacaagctcttc
aagattcgcaagagcattggagctgcggcaccttccaacagcatacaggcgacgcacgac
atccagaatgatatgggtgagggctccggcggcggagaaggtcagatcggcgacgatgag
gaggagtatggaggcgcacatggttccggagatggttccggcgatggaccccatacgccc
atcgaggaatccgaaggcaccaccaccaacgaagtggagtcgcgtgacagcggcaagacc
agtgggtccaacccactggaaggcaccgcgacgtggatgctcctcactctagtcacaatg
ctctttagtagctgtagttaa

DBGET integrated database retrieval system