KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4988Help
Entry
Dmel_CG4988       CDS       T00030                                 

Definition
(RefSeq) CG4988
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00010  Glycolysis / Gluconeogenesis
dme00052  Galactose metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG4988
   00052 Galactose metabolism
    Dmel_CG4988
Enzymes [BR:dme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dmel_CG4988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 34586
NCBI-ProteinID: NP_609514
FlyBase: FBgn0032372
UniProt: Q9VKF7
Position
2L
AA seq 368 aa AA seqDB search
MSITVEERNFGLATNPLTEARQMVHSYTLKNTKGMSVTVIQLGATIQSINFPDGSKKVED
VCLGFDDIAGYVTNKAAYMGGTLGRVANRVASGGFTLDETTVNLTRNVEGQFHLHGGFLG
FDSVIWEVVQKTPQGVVFRHESQHGHEGYPGILTCLITYRLDNEDRLSISFEATTDRQTI
VNLSNHAYFNLAGHNAGPKGLAEHTVEIASSEIVETDDRQIPTGELTLVDNTAYDLRSPV
VLGDRLKQFENCPIQGFDNCYVVNGGQLLRSTVKVAKIVHPPSGRALEVWTNQPGIQFYT
ANNITKITGKKGLFYVKHGALCVQTVKFPDAINHQNFPSINLNPNETYRHEVVYWFKVEK
TCRCCYKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaccgtagaggagagaaacttcggactggccacgaacccacttaccgaagcc
cggcagatggttcactcctacaccctaaagaacaccaagggcatgtccgtgacggttatt
cagcttggggccaccatccagagcatcaactttccggatggctccaagaaagtagaggat
gtgtgcctcgggttcgacgacatcgctggctatgtgaccaacaaggcggcctatatgggt
ggtaccctggggcgagtggccaaccgagtggccagcggtgggtttacattggatgagact
acagtaaacctgactaggaacgttgagggccagtttcatctgcacggtggattcttggga
ttcgacagcgtcatttgggaagtggtgcagaagacaccacagggtgttgtatttcgccat
gaatcccaacatggtcacgagggctatccaggcattctaacgtgccttatcacctatcgg
ctggacaatgaggaccgtttgtccattagtttcgaggccaccactgaccgccagacaatt
gtcaatctctcgaaccatgcctattttaatctagctggccataatgcaggacccaaaggt
cttgcagagcatacggtggagatagcatccagtgagattgtagaaacggatgaccggcag
attccaacaggggagttaacccttgttgacaacacggcttatgatctcaggtcacctgtg
gtcctgggagatcgcctcaagcagtttgagaactgtccgatccagggtttcgacaactgc
tatgtggtcaatggaggtcagctgttgagatctaccgtcaaggtggccaagatagtgcat
ccgccaagtggtcgggcactcgaggtgtggacaaatcagccaggcattcagttctatacc
gcgaataatataaccaagataactggcaagaagggattattttatgtgaaacacggcgcc
ctttgcgttcaaacggtgaagttcccggacgccataaatcaccagaatttcccgtcaatc
aatctaaaccctaatgaaacataccggcacgaagttgtgtactggtttaaggtcgaaaag
acctgcaggtgctgttataaaaagtaa

DBGET integrated database retrieval system