KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5065
Entry
Dmel_CG5065       CDS       T00030                                 
Symbol
CG5065
Name
(RefSeq) uncharacterized protein, isoform B
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    Dmel_CG5065 (CG5065)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG5065 (CG5065)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     Dmel_CG5065 (CG5065)
SSDB
Motif
Pfam: NAD_binding_4 Sterile 3Beta_HSD Epimerase Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind KH_dom-like Semialdhyde_dh KR
Other DBs
NCBI-GeneID: 36860
NCBI-ProteinID: NP_001163168
FlyBase: FBgn0034145
UniProt: A1ZAI5 E1JH83
Position
2R
AA seq 625 aa
MSHAVANKTETEAAPNSSLKQSAAPQPANSHDAKLLNGTLARTNGLTHAASVATSSSGSY
GSSSAAGSNAGSGGPTSSASLSIAAGVASSTALPLPPSSNGLQMPYERFRADDTSYVPIA
QFYAGRSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARLTELLNAPLF
ESLRQEKPKELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKLSV
TINMLGTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPPYNPDDIISLINWLP
EDILDQLTPRLIGKRPNTYTFTKALAEHMLLKEAGNLPVAIVRPSIVTASLNEPFAGWVD
NFNGPTGLVSALAKGMFRTMMCEKNYVADMVPVDIVINLMIAAAWRTATRKSNNLLIYNC
CTGQRNPIIWSEFVKHAMTSVRKHPLEGCLWYPTGDLRMNRPMNTLNCIAKHFLPAYILD
GVARIMGKKPFVVNVQNKIAKAVECLEYFATRQWRFKDDNVHALLHTLSPKDREIFVFDV
RHINWDKYVERYVLGFREFLFKQRPESLPASRKRMLRLYYLHQLTKLVAVLLTWRFLMSR
SKRLNDLWSSFLENALRMARLIPFL
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgtcacacgcggtagccaacaaaacggaaacggaagcagcgccaaacagcagcctcaaa
cagtccgcagccccccagcccgcaaacagtcacgatgccaagctgctcaacggcaccttg
gcccgaaccaacggactaacccatgccgccagcgtggccacctcctcctccggcagctac
ggcagctcgagtgcggccggatccaatgcgggctccggcggacccacctcatccgcgtcc
ttatccatagcggcgggggtggcgtcctcgacggccctgcccttgccgcccagcagcaac
ggccttcagatgccctacgagcgtttccgggcggacgacaccagctacgtgcccatcgcc
cagttttatgcgggacgtagtgtcttcatcacaggcggaactggatttatgggaaaggta
ctggtggagaagttgctgcgctcatgtccggaaataaggaatatctatctactgatacga
ccgaaacgcggtcaagaagtgtcagcacgactcacggaactactgaatgcaccactcttc
gaatcactgcgtcaggagaagcccaaggaactcagtaaagtcatacccatttcgggcgac
ataacttccgaggaactgggtatttcagaaaaagatcagaacctactgtgtcgcaatgtt
tccgttgtctttcactcggctgccacagtgaaattcgatgagaagctcaaactgtcagtc
acaatcaatatgctgggcacgaaacgcctcgtcgagctctgccatcgcatgctgtcactg
gacgcactaatccatgtatccactgcctattgcaattgcgatagaaccgatgtgtccgag
gttatctacgcaccgccctacaatcccgatgatatcatttcactaatcaactggcttccg
gaggatatactcgatcagcttacaccgcgcctgattggcaagcgtcccaatacgtacacg
tttacaaaagccttagcggagcatatgttacttaaggaggctggtaatctgcccgttgcc
attgtgaggccatcgattgtgactgccagtctgaatgagccgtttgccggttgggtggac
aacttcaatgggccaacgggcctggtttcggcgctggccaagggcatgttccgcacgatg
atgtgcgaaaagaactatgtggccgatatggtacctgtcgatattgtgattaacctgatg
atcgccgccgcctggcgcacagcgacccgcaagtcaaataacctactcatctacaattgt
tgcaccggccagcgcaatcccatcatctggtcggagtttgtcaaacacgccatgacgagt
gtgcgcaagcatcccctggagggctgcctgtggtatccgactggcgacctgcgcatgaac
cgacccatgaacacgctgaattgtatagccaagcactttttaccggcctacatactggac
ggagtggccagaatcatgggcaagaagccattcgttgtcaacgtacaaaataaaattgcc
aaagctgtggaatgcctcgagtactttgccacacgccaatggcgcttcaaggacgacaac
gtacacgccctgctgcacacgctaagtcccaaggatcgcgagatcttcgtcttcgacgtg
cgccacattaactgggacaagtatgtggagcgctacgttctgggcttcagggagttcctg
ttcaagcagcgacccgaatcgctgccggccagcagaaaacgcatgctcaggctctactat
ctgcatcagctgaccaaactggtggcggtgctgctcacctggcgctttttaatgtcgcgc
tcgaagcgcctgaatgacttgtggagctcctttctggagaacgcgctcaggatggcgcgc
ttgataccctttttgtaa

DBGET integrated database retrieval system