KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5072
Entry
Dmel_CG5072       CDS       T00030                                 

Gene name
Cdk4
Definition
(RefSeq) Cyclin-dependent kinase 4, isoform D
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG5072 (Cdk4)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dmel_CG5072 (Cdk4)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Dmel_CG5072 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 APH Kdo
Other DBs
NCBI-GeneID: 36854
NCBI-ProteinID: NP_001286493
FlyBase: FBgn0016131
UniProt: Q7K306
Position
2R
AA seq 317 aa
MSYVRQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRIS
LNENGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDL
IDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK
TYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQL
DRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLR
PSALACLEHDYFQQEPL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtcatatgtacgccagctgaagcggcagaaaatgtcccaggcgaagaagttcggcgat
ggcgatccgttcaactaccaggagctcaacatcatcggcgaaggtgcctatggaacggtt
tacagagcccgcgatgtgatcaccggcaacatagtggcgctgaagaaggttaggatatcg
ctgaacgagaacggtgtgccaatgtccacgctgcgggagatttcgctgctgaagcagctg
aatgccagcaatcatgcgaatattgtcaaactgtacgaagtatgccagtttctggagcgc
gacggccaattgctgattctgttggttttcgaacatgtggagcaggatctttcggatctt
atagacagacttcccaaatcgggcatgtcgccgcccacaattcagcgcttgtcaagggaa
ctactgaccggtgtggacttcttacactcacaccgtatcatccatcgggatcttaagccg
caaaacctgctggtctcctcgcagggccacctcaagatcgccgactttggcttggccaag
acctacggttcggagatgaagctcacctccgtggtggtcaccttgtggtaccgcgcaccc
gaggttctgctcgcccagccctacaacagcaccgtggacatctggagtgccgcctgcatc
atcttcgagatgttcaatcggcgcgccctattcccgggcacctccgaaaagaatcagctg
gaccgcatcttcgaactgaccggtagacccaccgagcaacagtggccacagaccatttcc
gtggccctggaacactttccccagcggcatccaaagagaccaaaagacttttgcccacac
ctgtgcaagtacgccgatgatctgttgaataaaatgctttcctacgacctccacctgcga
ccatccgccttggcctgtttggagcacgattactttcagcaggaacccctatag

DBGET integrated database retrieval system