KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5094
Entry
Dmel_CG5094       CDS       T00030                                 

Gene name
Sgt
Definition
(RefSeq) small glutamine-rich tetratricopeptide containing protein, isoform B
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG5094 (Sgt)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG5094 (Sgt)
SSDB
Motif
Pfam: TPR_11 TPR_1 TPR_2 TPR_8 TPR_17 SGTA_dimer TPR_7 TPR_19 TPR_14 TPR_12 TPR_16 TPR_9 TPR_10 TOM20_plant TPR_6 NARP1 TPR_MalT Fis1_TPR_C BTAD
Other DBs
NCBI-GeneID: 35052
NCBI-ProteinID: NP_001246058
FlyBase: FBgn0032640
UniProt: Q9VJD4
Position
2L
AA seq 331 aa
MPDAVQQSFVRSFIDYLKKQGDVMSPDQTESIEVAIQCLQAAFDLGDDVEAAPAAAGEEQ
ATTQSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQSLYTERNPESLALAESIK
NEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVYN
NNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRL
REDLINMLSQPMVRNLFNNAEIDVEQLLSMLQNPMIMNTIRQQFGGGNAPTLPNDMVQMI
YNMTSQLTGFPNSNANPGNEQQPGNQPPPST
NT seq 996 nt   +upstreamnt  +downstreamnt
atgccggacgcagtgcagcagagtttcgtgcgtagcttcattgactacctgaagaagcag
ggggacgtgatgtcgccggaccagaccgaaagcatcgaggtggcgatccagtgcctgcag
gcggcctttgacttgggcgatgatgtggaggcagcgccggctgcggctggtgaggagcag
gccaccacacagagcagcagcactgcgagcgcaccggacgatgatgcggtggccagcgga
agtgctggtatcggcgccgccgccgccgccgttcccaataacattgacatgttcgagctc
ttccagtcgctgtatacagaacgcaatccggaatccctggccctggccgaatccatcaag
aacgagggcaaccggctgatgaaggagaacaagtacaatgaagcactgctgcagtacaat
cgtgccatcgccttcgatcccaagaatccgatcttctactgcaatcgggctgcggcccac
atccggctgggtgagaacgaacgcgccgtaaccgattgcaagtccgccctggtgtacaac
aacaactacagcaaggcgtactgccgcctgggcgtggcgtactccaacatgggcaatttc
gagaaggcggaacaggcctacgccaaggccatcgagctggaaccggacaacgaggtgtac
aagagcaacctggaagcggccagaaacgccaggaaccagccgccccaaacggggcgatta
agggaagacctaatcaacatgctgtcccagccaatggttaggaatttgttcaacaacgcc
gagatcgacgtggagcagctgctgtcgatgcttcagaatccaatgatcatgaacaccatt
cgccagcagttcggcggcggcaatgccccgaccctgcccaatgacatggtgcaaatgatc
tataacatgaccagccaattgactggctttcccaattcgaacgcaaatcctggcaatgaa
cagcagccgggcaatcagccaccaccgagcacctag

DBGET integrated database retrieval system