KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5105
Entry
Dmel_CG5105       CDS       T00030                                 

Gene name
Plap
Definition
(RefSeq) phospholipase A2 activator protein, isoform B
  KO
K14018  phospholipase A-2-activating protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG5105 (Plap)
SSDB
Motif
Pfam: PUL PFU WD40 Drf_GBD
Other DBs
NCBI-GeneID: 43978
NCBI-ProteinID: NP_001245829
FlyBase: FBgn0024314
UniProt: Q9VPY2
Position
2L
AA seq 787 aa
MEPSLDNYKLSCELLGHSMDVRAVAVGPPTPEGRQTILSGSRDKSTKVWKPHGNEYLESL
TLQDHKNFISYICFLESERWICTASNDATICIYKQDGFVPLLTLKGHESTVCALSAGLEP
RSLISGSWDKTARVWTISEAGDVSFVALEGHEAAVWAVATLKEQRKYVTGGADRNIYYWN
AKGEKLRLLKGHTDCVRGVMGLDANTLLSCGNDAVLRFWNEDGECVREMNGHSNYIYSMA
RNEALGDQVVVSCGEDSTLRMWNVITGDELGAPIIHPGISVWSVTCLQNGDIVTGCSDGV
VRVFSHVPARQASEAVLKAFDLVVATRKSQINEEIGGVKKTDLPGPEALLSNGTREGQTK
MVRHADGSVKCYTWTLGNWNLVGDVTGATGGTQSNSGKKLHEGKEYDFVFSVDISDTEPP
IKLPYNRSDDPWQAAQTFIHRHSLPQAYLDQVANFIIKNSEGPVLMEQAPTGYQDPFTGG
SRYVPGSSNTNMGSGGNVDPFTGASSYSTASSNAQSQVDVNFVRSGDKHFPVSNYRIFDT
CDAKKVLEKMIEFNGKLSLPDGRVGEEVLLAVIKLADQSPELDLTSLEALAILLKWPASM
QFPVLDILRLAVRNEAIFSVLNNSHNFLATVIPQLSGSAPNQLMVVRCLANIMSHAAGRQ
NVMSRLAEIIDLVGAIKTGSANLQIAVATFYLNLTISQTLDVAKSEVCHVVTSGIVELLK
WAKDLEACYRSMQAIGNLTTTSCGQETIAQVVSVDYVMDKLRELTITPQDKNFSKVNSVG
QALLAVF
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggagccatcgttggacaactacaagctgagctgcgagctcctgggccacagcatggat
gtgcgggcggtagcggtgggacctccaactccggaaggtcgccagaccattctgtccggt
tcgcgggacaagagcaccaaagtctggaagccccatgggaacgagtacttggaaagcctt
actttgcaggaccacaagaacttcatctcgtacatctgcttcctggagtcggagcggtgg
atctgcacggccagcaacgacgccaccatctgcatctacaagcaggacggctttgtgccc
ctgttgaccctcaagggtcacgagtccacggtgtgtgctctctcggcaggattggagcca
cgaagcctcatcagcggcagctgggacaagaccgctcgggtgtggaccatcagcgaggcg
ggtgatgtgtccttcgttgctttagagggacacgaggcggcggtttgggcggtggccacc
ttgaaggagcagcggaagtatgtgactggtggtgcggacaggaacatctactactggaac
gcgaaaggcgagaagctgcgcctgcttaagggtcacacggattgcgtgaggggtgtcatg
ggactggatgcgaacacactgctctcctgcggaaatgacgctgttctccgcttctggaac
gaggatggtgagtgcgtgcgcgagatgaacggacacagcaactacatctactccatggct
cgcaatgaggctctgggcgaccaagtggtggtctcctgcggcgaggacagcacgttgcgc
atgtggaatgtgatcaccggcgatgagctgggagcacccatcatccatcccggcatttca
gtgtggtccgtaacgtgcctacagaacggggacattgtcaccggctgtagcgatggtgtg
gtgagggtattcagccacgttcctgctcgccaagcaagtgaagcagtccttaaagccttc
gacttagtagtggcaactagaaagtctcagattaatgaggagattggtggcgtcaagaaa
actgaccttccaggtccggaggctcttctgtccaatggaacgcgcgagggtcaaacgaag
atggtgcgccatgccgatggttccgtgaagtgctacacctggacgctgggtaactggaac
ttggtaggcgatgtaactggcgcaactggaggaacccagtcgaactccggcaagaaactg
cacgagggcaaggagtacgactttgtgttcagcgtggacatttccgacacggagccacct
atcaagttgccctacaaccgcagcgacgatccgtggcaggcggcccagaccttcatccat
cgccatagccttccacaggcctacctcgaccaggtggccaactttattataaagaactcg
gaaggccccgtgctgatggagcaggcgccaaccggctatcaggatccatttactggtggc
tcccgctatgttcctggatcgagcaacaccaatatgggaagcggcggcaatgtggatccc
ttcactggagcctcgagttactccacagcgagtagcaatgctcagtcgcaggtggatgta
aactttgtgcggtctggcgacaaacactttcccgtcagcaactaccgcatcttcgacacc
tgtgatgccaagaaggtgctagagaaaatgatagagttcaatggcaaactaagcctacct
gatggaagagtgggagaggaggtcttgttggccgtaatcaaactcgccgatcaatcgcct
gagctcgatctgacctccctggaagctctggccatcctgctgaagtggccggcgtccatg
cagttccccgtgctggacatccttcgcctggccgtgcgaaatgaagccatcttcagtgtc
ctgaacaacagtcacaacttcctggcgaccgttatccctcaattgagcggctcggcaccc
aaccagctcatggtggtgcgctgcctggccaacatcatgagccacgccgccggccggcaa
aatgtgatgtcccgtctggcggagatcatcgatctcgtgggagccatcaagacgggcagt
gccaatctgcaaattgccgtggccaccttctatttgaacctcacaatctcccagactctg
gacgtggcgaagtcggaggtgtgtcatgtggtcacctccggtattgtggagctgctcaag
tgggccaaggacttggaagcgtgctaccgttccatgcaggccatcggcaacctgaccacc
acttcgtgcggccaagagaccattgcgcaggtggtgtccgtggactatgtgatggacaag
ttgagggaacttaccattactccgcaggacaagaacttcagcaaggtgaattctgtgggc
caggccctgctggctgtgttctaa

DBGET integrated database retrieval system