KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5193Help
Entry
Dmel_CG5193       CDS       T00030                                 

Gene name
TfIIB
Definition
(RefSeq) transcription factor IIB, isoform B
  KO
K03124  transcription initiation factor TFIIB
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    Dmel_CG5193 (TfIIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dme03021]
    Dmel_CG5193 (TfIIB)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     Dmel_CG5193 (TfIIB)
 Prokaryotic type
  Archaeal type
    TFB
     Dmel_CG5193 (TfIIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N Sigma70_r4 BING4CT RB_B
Motif
Other DBs
NCBI-GeneID: 34430
NCBI-ProteinID: NP_001260349
FlyBase: FBgn0004915
UniProt: P29052 M9PCM4
Position
2L
AA seq 315 aa AA seqDB search
MASTSRLDNNKVCCYAHPESPLIEDYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSG
VDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEI
SSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEIC
AVSKISKKEIGRCFKLTLKALETSVDLITTADFMCRFCANLDLPNMVQRAATHIAKKAVE
MDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFP
EDFKFTTPIDQLPQM
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacatcgagactggacaacaacaaggtgtgctgctacgcacaccccgaatct
ccgctcatcgaggactacagggctggcgatatgatttgctccgagtgtggtctggtggtt
ggggaccgcgtaattgatgtgggctccgagtggcgtacctttagcaacgagaagagcggc
gtggatcccagtcgtgtcggtggaccggagaatccgctgctcagtggcggcgacttgtcc
accataattggtccgggcacaggatccgcatcctttgacgcctttggagcacccaagtac
caaaacagacgcaccatgagcagctcggatcgctccctcatatcagcctttaaggagata
tcctcgatggccgatcgcattaacttgcccaaaaccattgtcgatcgggccaacaacttg
ttcaaacaggttcatgatggaaagaacctcaagggtcgttccaacgatgccaaggcatcc
gcttgtctgtatatagcttgtcgccaagaaggagttcctcgcacattcaaggaaatatgt
gctgtcagcaagatcagcaaaaaagagattggccgttgctttaagctaacattgaaggct
ctcgagacaagtgtggatctcataaccactgcggacttcatgtgccgcttctgcgccaac
ttggacctgccgaacatggtccaacgcgctgccacgcacattgcaaagaaagccgtcgag
atggatattgtaccgggacgttcgccaatttctgtggccgcagccgcaatctatatggcc
tcacaagcatccgagcataagagaagccagaaggaaatcggtgatatagccggtgtggcc
gacgtcaccatcagacagtcctacaaacttatgtatccgcacgcagctaagcttttcccc
gaggactttaagtttaccactcccattgatcagttaccacagatgtaa

DBGET integrated database retrieval system