KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5196Help
Entry
Dmel_CG5196       CDS       T00030                                 

Gene name
CG5196
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20031  palmitoyltransferase ZDHHC6 [EC:2.3.1.225]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG5196 (CG5196)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dmel_CG5196 (CG5196)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    Dmel_CG5196 (CG5196)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC SH3_2
Motif
Other DBs
NCBI-GeneID: 41522
NCBI-ProteinID: NP_650191
FlyBase: FBgn0038039
UniProt: Q9VG80
Position
3R
AA seq 427 aa AA seqDB search
MSPEISGFRRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLA
TFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHH
CPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQF
TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDD
EFLYPYDLGWRANLRLVFNDECQKRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRTF
KCTRPVTGRWLPIFSQGWRVCVAAPCSDEPRISLRPNDMIKVTRFRNHWLFGERVLSEQE
LAGVKKRQRKGPIRGWFPRRSAVEVIEAVHEGSGDGNSETPAPAAQNGNAHSHLKQQQRN
GHAKKYM
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgaaatatccggcttccggcggttcctgcattggggccccattaccgccctt
agcatcatcaagtgcataacgctgacaacgctctatatgaactcgatgtggtggccgcca
aataaatcattcgccggattcgcccaccaggccctcttcctgctcctttccacgctggcc
acattcaattacgtcatggccactttgactggtcccggactgatgccaaaacagtggcat
cccaaggatcccaaggacgcccagttcctgcagtactgcaaaaagtgcgagggctacaag
gcaccacgctcccatcattgtcgcaagtgtgatcgctgcgtcaagaagatggaccatcac
tgcccatggatcaatcactgcgttggctgggccaaccacgcgtacttcacatacttcctg
ctcttctccatcctgggcagcctgcagggcaccgtggtgctgtgctgctccttctggcgg
ggaatctaccgctactactatctcacccacggattggcgcacttggctagcgtgcagttc
actctgctcagcatcatcatgtgcattctgggcatgggcctggccatcggtgtcgtcatt
ggcctgagcatgctgctgttcattcagctgaagacgattgtaaacaaccagacgggcata
gagatctggatagtggagaaggccatttaccgccgatataggaatgccgactgcgacgac
gagttcctatatccctatgatttgggctggcgggcaaatttgcgactggtattcaatgac
gagtgccaaaagcgaggcgatggcatcgagtggccagtggtggagggttgtgatcagtat
acattgacgcgcgagcaactggcgcagaaggaggagaaacgagctcgaacccgcaccttc
aaatgcacaaggccagtgactggccgttggctgccgatcttttcgcagggttggcgtgtt
tgtgtggccgctccctgctccgatgagccacgcatcagcctgcgacccaacgacatgatt
aaggtcactcgcttccgcaaccactggctgttcggcgagcgagtgctttccgagcaagag
ctagctggcgtcaagaagcgccaacgcaagggtcccattcgtggctggttcccacgacgc
agcgccgttgaggtcattgaggcggtccatgaaggcagcggcgatggcaacagcgagaca
ccagcacctgcggcccagaatggcaacgcccacagccacttgaagcagcagcagcgaaac
ggacatgccaaaaagtacatgtag

DBGET integrated database retrieval system