KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5320
Entry
Dmel_CG5320       CDS       T00030                                 

Gene name
Gdh
Definition
(RefSeq) glutamate dehydrogenase, isoform A
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00220  Arginine biosynthesis
dme00250  Alanine, aspartate and glutamate metabolism
dme00471  D-Glutamine and D-glutamate metabolism
dme00910  Nitrogen metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Dmel_CG5320 (Gdh)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dmel_CG5320 (Gdh)
   00220 Arginine biosynthesis
    Dmel_CG5320 (Gdh)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dmel_CG5320 (Gdh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG5320 (Gdh)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     Dmel_CG5320 (Gdh)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dmel_CG5320 (Gdh)
SSDB
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog
Other DBs
NCBI-GeneID: 42832
NCBI-ProteinID: NP_524470
FlyBase: FBgn0001098
UniProt: P54385
Position
3R
AA seq 562 aa
MYHLKSLARQGARRQQELATLAKALPTAVMQSSRGYATEHQIPDRLKDVPTAKDPRFFDM
VEYFFHRGCQIAEESLVDDMKGKLTRDEKKQKVKGILMLMQPCDHIIEIAFPLRRDAGNY
EMITGYRAQHSTHKTPTKGGIRFSLDVSRDEVKALSALMTFKCACVDVPFGGAKAGLKIN
PKEYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDI
NAHACVTGKPINQGGIHGRVSATGRGVFHGLENFINEANYMSQIGTTPGWGGKTFIVQGF
GNVGLHTTRYLTRAGATCIGVIEHDGTLYNPEGIDPKLLEDYKNEHGTIVGYQNAKPYEG
ENLMFEKCDIFIPAAVEKVITSENANRIQAKIIAEAANGPTTPAADKILIDRNILVIPDL
YINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLASVQQSIERIINDESVQESLE
RRFGRVGGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKYNLGLDLR
TAAYVNSIEKIFTTYRDAGLAF
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtatcacctgaagagtctggcccgccagggcgcccgccgccagcaggagctggccacg
ctggccaaggcactgcccaccgctgtgatgcagtcgagccgcggctatgccaccgagcac
cagattcccgaccgcctcaaggatgtgcccaccgccaaggatccgcgcttcttcgacatg
gtcgagtatttcttccatcgcggctgccaaatcgccgaggaatcgctggtggacgacatg
aagggcaagctgacccgcgacgagaagaagcagaaggtgaagggcatcctcatgctgatg
cagccctgcgaccacatcatcgagatcgccttccccctgcgccgcgatgccggcaactac
gagatgatcaccggctaccgcgcccagcacagcacccacaagacgcccaccaagggaggc
atccgtttctcgttggatgtgtcacgcgatgaggtcaaagccctgtccgccctgatgacc
ttcaagtgcgcctgcgtggatgtgccattcggcggagccaaggccggtctgaagatcaac
cctaaggagtactccgagcacgagctggagaagatcacccgtcgcttcacccttgagttg
gccaagaagggcttcattggacccggtgtcgatgtgcccgcccccgacatgggaaccggt
gagcgcgagatgtcctggattgccgatacttatgccaagaccatcggtcacctggacatc
aatgctcatgcctgtgtcaccggcaagcccatcaaccagggcggtatccacggacgcgtc
tcggccaccggtcgcggtgtcttccacggcctggagaacttcatcaacgaggccaactac
atgagccagatcggcaccactcccggctggggcggcaagaccttcatcgtccagggcttc
ggtaacgtgggcctgcacaccactcgctatctgacccgcgccggagccacctgcatcggt
gtcattgagcacgacggcactctgtacaacccggagggcattgaccctaagctgctggag
gactacaagaacgagcacggcaccattgtgggctaccagaacgccaagccctacgagggc
gagaacctcatgttcgagaagtgcgacatcttcattcccgctgccgtcgagaaggtcatc
accagcgagaatgccaaccgcattcaagctaagatcattgccgaggctgccaacggcccc
accacccccgctgccgacaagatcctcatcgatcgcaacatcctggtcattcccgatctg
tacatcaacgccggtggtgtcaccgtctccttcttcgagtggctgaagaacctgaaccac
gtctcgtacggtcgcctgaccttcaagtatgagcgcgagtccaactaccatctgcttgcc
tcagtccaacagtcaattgaaagaatcattaatgacgaatccgttcaagagtccctggag
cgtcgcttcggccgtgtgggcggtcgcatccccgtgaccccctccgagtcgttccagaag
cgcatctccggcgcctccgagaaggatatcgtgcactccggcctggactacaccatggag
cgctccgcccgcgccatcatgaagacagccatgaagtacaacctgggcctggacctcaga
accgctgcctacgtcaactccattgagaagatcttcaccacataccgcgatgccggcctg
gccttctaa

DBGET integrated database retrieval system