KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5363
Entry
Dmel_CG5363       CDS       T00030                                 

Symbol
Cdk1
Name
(RefSeq) Cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG5363 (Cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG5363 (Cdk1)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG5363 (Cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG5363 (Cdk1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dmel_CG5363 (Cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     Dmel_CG5363 (Cdk1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Dmel_CG5363 (Cdk1)
DNA replication proteins [BR:dme03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    Dmel_CG5363 (Cdk1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dmel_CG5363 (Cdk1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG5363 (Cdk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Haspin_kinase Seadorna_VP7 CzcE
Other DBs
NCBI-GeneID: 34411
NCBI-ProteinID: NP_476797
FlyBase: FBgn0004106
UniProt: P23572 C0MJ66
Position
2L
AA seq 297 aa
MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKH
ENIVCLEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCH
RRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPR
YSCPVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNT
FPCWSTNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQSGLVRN
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaggattttgagaaaattgagaagattggcgagggcacatatggcgtggtgtataag
ggtcgcaaccgcctgacgggccaaattgtggcaatgaagaaaatccgcttggagtccgac
gacgaaggcgttccatcaaccgcgatcagagaaatttcgttgcttaaggagttgaaacat
gaaaacattgtctgtttggaggatgttttgatggaggagaaccgcatatacttgatcttt
gaattcctatcgatggacctcaagaaatacatggattcgctgccagttgataagcacatg
gagagtgaattggtccgtagctatttgtaccaaataactagcgccattcttttctgccat
cgtcggcgagtacttcaccgtgatcttaagccgcagaacttactaatcgacaagagtggc
ctcataaaagtcgccgactttggacttggccgatcctttggcattccggtgcgcatttat
acgcacgagattgttaccttgtggtacagagcgccggaggtgctactgggttcaccccgg
tattcctgtcccgtcgatatctggtccattggatgcatattcgcggagatggcaacgaga
aagccgctattccagggtgactcggaaattgaccagttgtttagaatgtttagaattctg
aaaacacctaccgaagacatttggccgggcgttacttcgctacccgactataagaacacg
ttcccctgctggtccacgaaccaattgaccaatcagttaaagaatctcgatgcgaatggt
attgatctcatacaaaagatgttaatctacgatccagttcatcgcatttccgccaaggac
attttggagcatccctatttcaatggttttcaatcgggcttagttcgaaattaa

DBGET integrated database retrieval system