KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5417
Entry
Dmel_CG5417       CDS       T00030                                 

Gene name
Srp14
Definition
(RefSeq) signal recognition particle 14
  KO
K03104  signal recognition particle subunit SRP14
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03060  Protein export
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dmel_CG5417 (Srp14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dme02044]
    Dmel_CG5417 (Srp14)
Secretion system [BR:dme02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   Dmel_CG5417 (Srp14)
SSDB
Motif
Pfam: SRP14 Baculo_E56
Other DBs
NCBI-GeneID: 42436
NCBI-ProteinID: NP_650896
FlyBase: FBgn0038808
UniProt: Q9VDL0
Position
3R
AA seq 109 aa
MVLLDNSNFILRLEKIANAAKKDSSFTLTFKRYDGNDKPVPREGRPPLPKPETYMCLMRA
QSKSQKISTVVRQEDVPAMMSMYSQFMKSKMDGLKRVKKVKSKAKATKG
NT seq 330 nt   +upstreamnt  +downstreamnt
atggttttgctagacaattcgaactttatcctgcgcctggagaagatcgcaaatgcggcc
aagaaggactcctccttcacgctgacgttcaagcgatatgatggcaacgataagcccgtg
ccgagggaaggacggccaccgctgcccaagccggagacctacatgtgcctgatgcgcgcc
cagtccaagtcccaaaaaatttccaccgttgtccggcaggaggatgtgcccgccatgatg
agcatgtactcgcagttcatgaagagcaagatggacgggctaaagcgggttaagaaagtc
aaaagcaaggccaaggcgacaaagggttaa

DBGET integrated database retrieval system