KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5429
Entry
Dmel_CG5429       CDS       T00030                                 

Gene name
Atg6
Definition
(RefSeq) Autophagy-related 6
  KO
K08334  beclin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04136  Autophagy - other
dme04137  Mitophagy - animal
dme04140  Autophagy - animal
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG5429 (Atg6)
   04136 Autophagy - other
    Dmel_CG5429 (Atg6)
   04137 Mitophagy - animal
    Dmel_CG5429 (Atg6)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    Dmel_CG5429 (Atg6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG5429 (Atg6)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG5429 (Atg6)
Membrane trafficking [BR:dme04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    Dmel_CG5429 (Atg6)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dmel_CG5429 (Atg6)
SSDB
Motif
Pfam: APG6 APG6_N DUF2147 GAS DUF812 V_ATPase_I AAA_11 Atg14 FapA
Other DBs
NCBI-GeneID: 42850
NCBI-ProteinID: NP_651209
FlyBase: FBgn0264325
UniProt: Q9VCE1
Position
3R
AA seq 422 aa
MSEAEKQAVSFACQRCLQPIVLDEQLEKISVHAMAELSLPIYGDNGNTLDPQDASSFDHF
VPPYRLTDSINGTGFMLVSDGRDNKKMSAAFKLKAELFDCLSSNSEIDHPLCEECADSML
EIMDRELRIAEDEWDVYKAYLDELEQQRVAPNVEALDKELDELKRSEQQLLSELKELKKE
EQSLNDAIAEEEQEREELHEQEESYWREYTKHRRELMLTEDDKRSLECQIAYSKQQLDKL
RDTNIFNITFHIWHAGHFGTINNFRLGRLPSVSVDWSEINAAWGQTVLLLSALARKIGLT
FERYRVVPFGNHSYVEVLGENRELPLYGSGGFKFFWDTKFDAAMVAFLDCLTQFQKEVEK
RDTEFLLPYKMEKGKIIDPSTGNSYSIKIQFNSEEQWTKALKFMLTNLKWGLAWVSSQFV
SP
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagtgaggcggaaaagcaggcggtgtccttcgcctgtcagcgctgcctgcagcccatc
gtcctggacgagcagctggagaagattagcgtgcacgcaatggcggagttatctttgccc
atctacggagacaatggcaatacattggacccgcaggacgccagcagcttcgaccacttt
gtgccgccctacaggcttacggactctataaatggcactggttttatgctggtttccgat
ggcagggacaacaagaaaatgagtgctgcttttaagctgaaagcggagctgtttgactgc
ctctcctccaactctgagattgaccatccgctgtgcgaagagtgtgccgactccatgctg
gaaatcatggacagggaactgcgcatcgctgaggacgagtgggatgtgtacaaggcttat
ttggatgaactagagcaacagcgtgtagcacccaacgttgaggccctggacaaggagctc
gacgaactaaagcgcagcgagcaacagcttctgtcggagctaaaagagctcaaaaaggag
gaacaatcgctaaatgatgccattgccgaggaggaacaggagcgagaggagctgcacgag
caggaggaaagctactggcgcgagtataccaagcacaggcgtgagctaatgctcaccgag
gatgacaaacgaagtctggagtgtcagatcgcctactcgaaacagcagctggacaaactg
cgcgacaccaacatattcaacatcacctttcacatctggcatgccgggcatttcggtacc
attaataactttaggctgggtcgattgccctctgtatccgtggactggtcagagatcaac
gccgcttggggccagacggtgcttctgctctctgcgcttgctcgtaagatagggctcacc
ttcgagcggtatcgtgtagtaccctttggaaatcattcgtatgttgaggtgctcggcgag
aatcgagagctcccgctttatggcagcggcggatttaagtttttctgggacaccaagttt
gatgctgccatggtagcttttctcgactgtcttacccagttccagaaggaggtcgagaag
cgcgacaccgagttcctgctgccctacaagatggagaagggcaagatcatcgatccctcc
acgggaaattcctattctattaaaatccagtttaactcggaggagcagtggaccaaggca
ctgaaattcatgctaaccaacctgaaatggggattggcctgggtttcttcacagtttgtg
tcaccgtga

DBGET integrated database retrieval system