KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5463Help
Entry
Dmel_CG5463       CDS       T00030                                 

Gene name
GatB
Definition
(RefSeq) Glutamyl-tRNA amidotransferase, subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00970  Aminoacyl-tRNA biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dmel_CG5463 (GatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG5463 (GatB)
Enzymes [BR:dme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dmel_CG5463 (GatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dmel_CG5463 (GatB)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dmel_CG5463 (GatB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF3983
Motif
Other DBs
NCBI-GeneID: 42861
NCBI-ProteinID: NP_651217
FlyBase: FBgn0039153
UniProt: Q9VCD0
Position
3R
AA seq 516 aa AA seqDB search
MHYSIIRKLVTAPKLANVPKRKWKSVVGLEVHAQIASASKLFSGSGTSFGAPLNSSVAYF
DASIPGTLPVLNRKCVESGIKTSLALGCRVNEVSMFDRKHYFYADLPNGYQITQQRAALA
NDGKMTFPVITPGKKVYYKTAKLLQLQLEQDSGKSLHDDYLKRSLVDLNRAGLPLMELVF
APDLETGEEAASLVKELILILRRLQTCSCKMEEGALRVDANISIHQEGDPLGVRTEVKNI
GSVRSISQAITYEINRQLETVANGGVITNETRNWDAENRRTVAMRDKEVLQDYRFMPEPN
LPPLHVNLKPGSMSTEDLLSVAALSEEIPELPEDTRQRLVEQHNLNAETAIILVNEPILL
DHFLSITRSLSDLPNKVICNFLINDLLTYCNKLNLDVEDCSIKADDLKDILMSLHAELIN
LQAARQLVDLLHNNPKAKVSELIELHSLQQICSPDEIENLCQLAIANQAKAVEQYQKGKA
KALFAIAGEVAKLSSQKANMKLVVQRLEKLLKPTNK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcattactcaataatccgaaaactggtaacggcgccaaagctagccaacgttcccaaa
aggaaatggaaaagcgttgtgggtttggaggtgcacgcacagattgccagtgcgtccaaa
ctgttttccggcagtggcacatcctttggagcaccacttaactcttcggtggcgtatttt
gatgcctccataccgggaacattgccagttctcaacagaaaatgtgtggaatccggcatt
aagacatcacttgctttgggatgtcgggtgaacgaagtgtccatgtttgaccgcaagcac
tacttctatgcagatttgcctaatggctaccaaatcacgcagcagcgcgccgctttggcc
aatgatggaaaaatgactttccccgtgataacaccaggcaaaaaagtttactacaagacc
gccaaactactgcagttgcaattggaacaggatagtggtaaatctctgcacgatgattat
ctcaaaaggagcctggttgaccttaatcgtgctggacttcctctaatggagctggttttt
gcaccagatttagaaacgggcgaagaagcggcatcgctggtcaaggaattaatactgata
ctaaggcgtctgcagacatgcagttgtaaaatggaagagggcgccctgcgtgtggatgcc
aacatatccattcaccaagaaggcgatcccttgggagtccgcaccgaagtaaaaaacatt
ggctcggttcgaagcatttcgcaagcaattacgtatgaaattaatagacagctagaaact
gtggctaatggcggtgtaattacaaatgagactcgcaactgggatgcggagaaccggcgc
acagtggccatgcgtgacaaagaggtgctgcaggactacagattcatgccggagccgaat
ctaccaccccttcatgtaaacctaaagcctggatcaatgtcaacagaggatttactttca
gtggctgctctaagcgaggaaattccagaattaccagaggacaccaggcaacgtttggtg
gagcagcacaacctgaatgcggaaactgccatcattttagtgaacgaacctattctgctg
gatcatttcttgagcattacccgtagtttaagtgatttgcccaacaaagtcatttgcaat
tttcttataaacgatttgttgacctattgcaacaaattgaacttagatgtggaggattgc
tccattaaggctgatgatttgaaagatatattaatgagcttgcatgccgagctgataaat
ctccaggcagcacgtcagctggttgatctgcttcataataaccccaaagcgaaagtcagt
gagctaatcgaactgcacagcctgcagcaaatctgcagtccggacgagatcgagaacctg
tgccagctggctatcgccaaccaggccaaggcagtcgaacagtaccagaaaggcaaggca
aaagctttgttcgcgatcgcaggcgaagttgccaaactgtcgtcccaaaaggccaacatg
aagctggtagtgcagcgtctggaaaagctgctaaaacccaccaataagtaa

DBGET integrated database retrieval system