KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5484Help
Entry
Dmel_CG5484       CDS       T00030                                 

Gene name
Yif1
Definition
(RefSeq) Yip1d-interacting factor 1, isoform C
  KO
K20362  protein transport protein YIF1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG5484 (Yif1)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    Dmel_CG5484 (Yif1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: YIF1 Yip1 ApoA-II
Motif
Other DBs
NCBI-GeneID: 43217
NCBI-ProteinID: NP_651498
FlyBase: FBgn0039450
UniProt: Q8IMR4
Position
3R
AA seq 402 aa AA seqDB search
MNYNPNPGMRNRKWENSSAAGRPRPPKRVSDVNAMGPSAPMMGGGATFMAPPTGPGILDP
NMYGAPAPAPVNSYGFDPNLGQPSQHIQQPPQQQPGYGYGAPPPQQAAGPPTYGIGAPQP
VAPPTGQYPQFAMFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNA
YVGRKLRLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQ
KRFSPEQLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLM
VSTLFFKSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYS
GGKKRKLYFLFMIVAGQALFAFLLSKHLYLPEAEVLTVPKTF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaactacaatccaaatccgggtatgcggaaccgtaagtgggagaactcctcagctgcc
ggtcgcccaaggccgccgaagcgtgtgagtgatgttaacgccatgggaccctcggctccg
atgatgggcggtggcgccaccttcatggccccgcccaccggccccggaatactagatccc
aatatgtacggagcacctgctccggccccggtcaacagctatggcttcgaccccaatctc
ggccagccctcgcagcacattcagcagccaccacaacagcagcccggatacggatatgga
gcaccacctccccaacaggcggctgggccacccacctacggaataggagcacctcagcct
gtagctccacccactggacagtacccacagttcgccatgttccagcagcccatcgtgcaa
gacatggctatgcagtacggtcagaaactagcggatcagggcaagcagatcatggagaat
cagttcgagaagtgggtgcccgtagccaagctcaagtactacttcgcagtggacaacgcc
tacgtgggcaggaagttgcgccttctgtttttcccctatatgcataaggattggtccctg
cgctacgaccaagagcacccagtgcaaccacgatatgatgttaatgcgccagatctctat
ctgcccaccatgggctacatcacatacgtgatcgtagcgggtttgcttctgggcatgcag
aagcgattttcgccggagcagctcggcattcaggcctccagcgccatggcatatagcatt
ttcgaattggtcatttactccctagccctgtacgtaatgaatgtgaagacgagcctgaaa
acgcttgatctgctggcattcactggttataagtacgttaatatagttgtctgcctgatg
gttagcacgctgttctttaagtctggatattatatagcactggcgtataccagtttctcc
ttcggtttcttcatgctccgcacgttgcggacgaaactgctgcaggacaactccccggct
gcgcccagtggagccatcaactacgatccgtatggcaatccacagcaatttgactacagc
ggcgggaaaaagcgcaaactctacttcctgttcatgatcgtcgcgggacaggcgctgttc
gccttcctgctctccaagcacctgtatctgcccgaggcggaggtgctgacggtgcccaag
accttctaa

DBGET integrated database retrieval system