KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5489Help
Entry
Dmel_CG5489       CDS       T00030                                 

Gene name
Atg7
Definition
(RefSeq) Autophagy-related 7, isoform A
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04136  Autophagy - other
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG5489 (Atg7)
   04136 Autophagy - other
    Dmel_CG5489 (Atg7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG5489 (Atg7)
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG5489 (Atg7)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG5489 (Atg7)
Membrane trafficking [BR:dme04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    Dmel_CG5489 (Atg7)
   Atg8 conjugation proteins
    Dmel_CG5489 (Atg7)
Ubiquitin system [BR:dme04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   Dmel_CG5489 (Atg7)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dmel_CG5489 (Atg7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG7_N ThiF Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 37141
NCBI-ProteinID: NP_611350
FlyBase: FBgn0034366
UniProt: Q7JY94
Position
2R
AA seq 684 aa AA seqDB search
MSTEKEIILQFAPWESFVSPTFWHKLAELKLDHDRLSDSKRSITGHYTNRNASGCLLEVD
YTAYNRMAKPPKFSHSAIGTIYNKNTIEEFKALDKLQLLADEGKELLADMCSGGALRDPS
LLTRFFVLSFADLKCHSYYYWFAFPCPLTPTLKLQGAVQKLRDLPNSSSYIMALKALPTE
SQNFFILYANVEKNIFEARSLSSLDDKNVEFCYFGFADPSEYEHPAWIMRNYAAFLLQQC
PSFVGKPLKFLGLRHNQQMNIDDSLVWKVIQTEACDLSQSENIKFVGWELNKNGKMGPRM
VCMRDSMDPAKLAENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLS
WGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAETAGYVLE
IPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVINA
ALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQ
CTVTRPGVSNIAASYAVELLVALLQHPRKELAPAYYAQSGRGRSEETEEKVPEGLLGILP
HSIRGMLCNYENILPATQKFAQCIACSAAVLNEYKKEGHAFLFKTFETAKFLEDLTGISE
FKRLNSEIIDFDDEEFDMSDSDED
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaaaaagagataattttgcaatttgctccgtgggaatcttttgtgtcgccc
actttctggcacaagctagcggagcttaagctcgaccacgatcgcctgtccgactcgaaa
cgctccattactggacactacacaaatcgtaatgcaagtggatgccttttggaagtagac
tacacggcctacaacagaatggcaaagcctccaaaattcagccattccgctataggcacc
atctacaataagaacacaatcgaagagttcaaggccctggacaaattacaactgctggcc
gatgagggcaaggaactgctggctgatatgtgcagtggtggcgccttgagagatcccagt
ctattgacccggttctttgttctctcctttgccgatttaaagtgtcacagctactactat
tggttcgcctttccgtgcccgctgacgcccaccttaaagcttcagggagccgtccaaaaa
ctgcgggacttgcccaatagtagtagctatataatggctctaaaggccttacccactgag
tcacagaacttcttcattctgtatgctaatgtggagaagaacattttcgaagcccgtagt
ttaagttcccttgacgataaaaatgttgagttctgttattttggttttgctgatcccagc
gagtatgagcatccagcttggataatgcgaaactatgctgcctttctgcttcagcaatgt
ccctcttttgttggaaaaccattgaagtttcttggcctgcgacacaatcaacaaatgaac
atcgatgacagccttgtatggaaggtgattcagactgaagcttgcgatcttagccaaagc
gaaaatataaagttcgtgggctgggagctaaataaaaatggcaaaatggggccaagaatg
gtgtgcatgagggacagcatggatccagccaaactcgctgagaactctgtaaacctgaac
ctgaaactaatgaagtggcgccttgttcccgatctcaatctcgaaatcatctcccaaaca
aaatgcctgctctttggagctggtactttaggatgcgctgtagctagaaatctgctgtcc
tggggatttaagcacataacccttttggacagcggcaaggttgggttctctaatccagtg
cgtcagaatctctacacgcatgcagatgctgtggcaggcaatcggatgaaggcgactaca
gctgctcagagattgaaagagatcaatccgtctgcggaaacggcgggttatgtgctggag
attcccatgcctgggcatactattggagaatcgcttctagcccagacgaaggagcatttg
aaggttatcgaaaagcttgtgcaggaccatgatgtcatctttctgctcacagattcgcgc
gaaagccgctggctgcccaccctgcttggagcggcaaaggaaaaaattgtcatcaacgca
gctttaggctttgacagttatctggtaatgcgacatggcactacgcgtaaggaagcaggc
gacgatggccaagaaatcgaaggacttaagtgcattaatggcgatcaattaggttgctac
ttttgtaacgatgttacggcccctggaaattcgctcaaagaccgaactttggatcaacag
tgcacagtgacacgacccggagtatccaacattgcggccagctatgcggtggaattgttg
gtggctttgctgcagcatcctcgtaaggagctggcacccgcctactatgcacagagtggg
cgtggcaggtcggaggagacggaagaaaaggtgccggagggtctgctaggaattttgcct
cactccatccgtggaatgctgtgcaactacgagaatattctgcccgccactcaaaagttt
gctcagtgcatagcctgttcagcggccgtcctaaatgaatataaaaaagagggtcatgct
ttcctgtttaaaacttttgaaacagccaagtttctggaggatttgacgggaatctccgaa
ttcaagcggttaaacagcgagattatcgattttgatgatgaagaatttgacatgtccgat
agcgacgaggattag

DBGET integrated database retrieval system