KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5641
Entry
Dmel_CG5641       CDS       T00030                                 

Gene name
CG5641
Definition
(RefSeq) uncharacterized protein
  KO
K13089  interleukin enhancer-binding factor 2
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG5641 (CG5641)
Spliceosome [BR:dme03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    Dmel_CG5641 (CG5641)
Motif
Pfam: DZF SMODS
Other DBs
NCBI-GeneID: 41529
NCBI-ProteinID: NP_650196
FlyBase: FBgn0038046
UniProt: Q9VG73
Position
3R
AA seq 396 aa
MVRGALRGGRPMRGGIRPPFKKTFVPRHPFDLTLAEVFFPKVPSAGAVDDSALTAALLKR
NQDLSPTPSEQTAIGNLVTKVQAVLDNLVVAPGDLTTCQLEEVRQVGSFKKGTILTGNNV
ADVVVILKTLPTKEAVDALAKKVEADLKASMKTEVLTKGDQHTVQIHERGFDIANVHAKV
RILIATLPQNLRKLEPEIHLDHKLMQSHLAAIRHTRWFEENAHHSSIKVLIRILKDLTRR
FDAFSPLSAWMLDLIAHLAIMNNPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDPTEP
GHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHILGLEGNTSVVREMSVWNGVCISPL
TAVYEKPTDKKEGDLEEDIDMIENENEEEGSDDGAE
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggttcgcggagctctccgaggtggccgccccatgcgcggcggcatacgtccgccgttc
aaaaagacattcgtgccgcgccaccccttcgatctgaccctcgcggaggtcttctttccc
aaagttccatccgccggcgccgttgacgattctgctttgactgcggcgctgctgaagcgt
aaccaggacctgagtcccactcccagcgagcagacggctattggcaatctagtgaccaag
gtgcaggctgttctcgacaatctggtggttgcacccggggatctgacaacttgtcaactg
gaggaagtgcgtcaggttggctccttcaagaagggcaccatactgacgggcaacaatgta
gccgatgtggtggttatcctcaaaaccctgcccaccaaggaggccgtcgatgcgctggcc
aaaaaagtggaggccgacctgaaggccagcatgaagactgaagttctgaccaagggcgat
cagcacaccgtacagatccatgagcggggcttcgacatcgccaacgtgcatgccaaggtg
cgcattctgatcgccaccttgccgcagaatcttcgcaagctggagcctgagatccatttg
gatcacaaactgatgcagagccatctggctgccattcggcacacgcgctggtttgaggaa
aatgcccaccactcctcgataaaggtgctcattcgcattctcaaggatctcactaggcgt
ttcgacgctttttcgccgctgtcggcctggatgctggacctgatcgcccatttggccatc
atgaacaacccgtcgcgacaggcactgcccatcaacctggccttccgtcgcgtctttcag
ctactctccgccgggctcttcctgccgggctcggccggcatcacggatcccaccgagccg
ggacacatccgtgtgcacactgccatgacattggagcagcaggatgtgtgctgctacaca
tcgcagacactactgcgcgtgctggcccacggcggatacaaacacattttgggactggag
ggcaacaccagcgttgtgcgcgaaatgtccgtctggaacggcgtgtgcatttccccgctg
accgctgtctacgagaagccaacggacaagaaggagggcgacctcgaggaggacatcgac
atgatcgagaatgagaacgaagaagagggcagcgacgatggcgccgagtaa

DBGET integrated database retrieval system