KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5665
Entry
Dmel_CG5665       CDS       T00030                                 
Symbol
CG5665
Name
(RefSeq) uncharacterized protein, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Lipase
Other DBs
NCBI-GeneID: 40243
NCBI-ProteinID: NP_001246844
FlyBase: FBgn0036977
UniProt: M9NFL7
Position
3L
AA seq 395 aa
MRILCGIVILLRLGALGDIAVDEEGRLTRSWWDAVPRLLTDIATIKANILTAAPLELASN
IIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV
ILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGV
GLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLI
PRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQ
PGCLTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSPMGYRMNPQ
ARGIYYVDVNGWPPYGRNSENTVDPRLKTCYLCRR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaggattctgtgtggcattgttatcctattacgcctcggagcattgggagatatagct
gttgacgaagagggaaggttgacgcgaagctggtgggatgcagtgcctagacttttaact
gacatcgccaccattaaggcgaacatactcacagctgctccacttgaattggcttccaac
ataattgatgctgtgtgttcttccaccctctttatggacagaatccctgcgcaaatcact
ccggacataaggaagatgcattttcagtacatgacgccgtgccagaactacagtgtgccc
ctgctggaggcctcgaagctgtggaagcactctcgattcagcaagggacgtaaggtggta
attctggccaccggatggaccaacaccgtaaacgaatcctcggccatttcgatgatctct
aaggcattcatgtgtcgtggcgatgtgaattttgtgattgtagatgcggctgactatgtg
gacaccttctacgcgtggtcggcgctgaacacggatttaattggagagcatattggagtt
ggtctgacccaccttatagagctgaccccacttcgaaatattcacttgattggtgggttc
ataaaggaatcctttgtgtccataaattctggttctgatttctttgtaggacattcacta
ggagctcacattatgggcactgctggtcggacttttaagaagcttaccggaaaacttata
cccaggataactggcttggatccggccaagccatgtttcaggcgggaaaagattctgcca
ggattgacgcgtggcgatgccaagctagtggacataatccacaccaacattggtattttg
gccaagcgtggacccctcggtgatgtggacttctatcccggcggagcacatcccatccag
ccaggctgcctaaccatcggatgctctcatacccgagccgttgagtatttcgccgagagt
gcatatccacaccaagagaagaactttatgggcaagaagtgcgcttcttgggatgagcta
agaaaacgggattgttctgctggcatagtttccccgatgggctatcgaatgaatccccaa
gccaggggcatctactacgtagatgtcaatggctggcccccttacggccgaaactcggag
aacactgttgatcctaggcttaaaacgtgctacttgtgccggaggtga

DBGET integrated database retrieval system