KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5680Help
Entry
Dmel_CG5680       CDS       T00030                                 

Gene name
bsk
Definition
(RefSeq) basket, isoform F
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04137  Mitophagy - animal
dme04140  Autophagy - animal
dme04141  Protein processing in endoplasmic reticulum
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
dme04310  Wnt signaling pathway
dme04391  Hippo signaling pathway - fly
dme04624  Toll and Imd signaling pathway
dme04933  AGE-RAGE signaling pathway in diabetic complications
Module
dme_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG5680 (bsk)
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG5680 (bsk)
   04310 Wnt signaling pathway
    Dmel_CG5680 (bsk)
   04391 Hippo signaling pathway -fly
    Dmel_CG5680 (bsk)
   04068 FoxO signaling pathway
    Dmel_CG5680 (bsk)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG5680 (bsk)
   04137 Mitophagy - animal
    Dmel_CG5680 (bsk)
  Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG5680 (bsk)
   04215 Apoptosis - multiple species
    Dmel_CG5680 (bsk)
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG5680 (bsk)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG5680 (bsk)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG5680 (bsk)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dmel_CG5680 (bsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 44801
NCBI-ProteinID: NP_001162930
FlyBase: FBgn0000229
UniProt: P92208 E1JHD6
Structure
PDB: 

Position
2L
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccaacactacaccgtcgaggtgggggacaccaacttcaccatc
cacagtcggtacattaatctacggcccataggatcaggtgcccaaggaatagtatgcgcc
gcttacgatactatcacccagcaaaatgtggcgattaagaaactatctcgaccattccaa
aatgtaacccatgccaagcgagcatatagggaattcaagctaatgaagcttgttaaccat
aaaaacataattggcttacttaatgcttttacgccgcaaaggaacttggaagagtttcag
gatgtctacctggtcatggagctgatggacgctaatctctgccaggtcatccaaatggac
ttggatcacgacagaatgtcctatttgctttatcaaatgttgtgcggaataaaacattta
cactcagcaggaattattcacagagacttaaagccatccaatatagttgtaaaggccgac
tgcactctaaaaattttggatttcggtctggcacgtactgcaggaactacctttatgatg
actccctatgtggtcacccgatattacagggctccagaggtcattttgggcatgggatac
acagagaacgtggacatatggtccgtcggttgcattatgggcgaaatgatacggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatcaccctcgtttatgcaacggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttccaaat
gataataatcagaatagccgccggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcatgaatatatc
aacgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatatgatcacagc
gtggacgaaagggaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaatacaaataatagaacgcggtag

DBGET integrated database retrieval system