KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5706
Entry
Dmel_CG5706       CDS       T00030                                 
Symbol
beta-PheRS
Name
(RefSeq) Phenylalanyl-tRNA synthetase, beta-subunit
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dmel_CG5706 (beta-PheRS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dme01007]
    Dmel_CG5706 (beta-PheRS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dme03016]
    Dmel_CG5706 (beta-PheRS)
Enzymes [BR:dme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     Dmel_CG5706 (beta-PheRS)
Amino acid related enzymes [BR:dme01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   Dmel_CG5706 (beta-PheRS)
Transfer RNA biogenesis [BR:dme03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Dmel_CG5706 (beta-PheRS)
 Prokaryotic type
    Dmel_CG5706 (beta-PheRS)
SSDB
Motif
Pfam: tRNA_synthFbeta PhetRS_B1 B3_4 B5 EAD7 DUF2740
Other DBs
NCBI-GeneID: 42888
NCBI-ProteinID: NP_651237
FlyBase: FBgn0039175
UniProt: Q9VCA5
Position
3R
AA seq 589 aa
MPTIGVKRDLLFEALGKTYTDDEFQDLCFAFGLELDEVTTEKQMLTKEQGDVAAAANASE
EIIYRIDIPANRYDLLCLEGLVTGLLVFQGKLKPPKFQFVELAKRQVLKIDPSTAQIRPY
AVAAVLRNVTFTQASYNSFIDLQDKLHQNICRKRTLVAIGTHDLDTLQGPFSYEALAPDQ
IKFKPLNQTKEMTGSELMDFYSTHAQLKQYLPIIRESPVYPVIYDANRVVLSLPPIINGD
HSKITLKTKNVFIECTATDRTKAKVVLDTIVCLFSEHCAQKFTVEPCDVVQPDGSVISYP
ELEVREERISVKRANAYIGIDEPAEKLADMLTRMYLEAKVDGDSLVVKIPPTRHDVIHAC
DIYEDVAIAYGYNNIKKSLPAFMQIAKQFPLNKLTEQLREQVAQAGFTEALTFTLCSRDD
IGRKLNKNIDALPAVHIGNPKTLEFQVVRTTLLPGLLKTLVANRKMPLPLKLFEISDVVV
ADESTEVGARNERRVCAVNCNKTAGFEVVHGLLDRVMQLLSVPWKSASGTKGYYLQATED
PSYFPGRCANVMYDGVVIGKIGVLHPTVLQAFELTTPCSAVEFTIEPFV
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgcccaccattggagttaaacgtgatctgctcttcgaggcgctcggcaagacgtacacc
gatgatgagttccaggatctctgctttgccttcgggttggagctggacgaagtgaccacg
gagaagcagatgctgaccaaggaacagggcgatgtggcagcggcggccaatgccagcgag
gagatcatatacagaatcgacatacccgccaatcggtatgatctgctctgtttagagggc
ttggtcacgggtctgctggtattccagggaaaactcaagccccctaagttccagtttgtg
gagctggccaagaggcaggtgctgaagattgacccttcgacggcgcagatccgtccgtac
gctgtggccgctgtgctccggaacgtgacttttacgcaggcctcctacaacagcttcatc
gatctgcaggacaagctgcatcagaacatctgccggaagcgtactctggtggctatcgga
acgcacgatctggacaccctacagggacccttcagttacgaggctctggcgccggatcaa
atcaagttcaaaccacttaaccaaaccaaggagatgactggcagcgagctcatggacttc
tattccacgcatgcgcagctgaagcaatatctgccaatcattcgggaatcaccggtttat
ccagtgatctacgatgccaaccgtgtggtgctttcactgccgcccatcatcaacggtgat
cattccaagattacgctgaagaccaagaacgtattcatcgagtgcacggccacggataga
acgaaggcaaaagtggtgctggacaccattgtgtgcctcttttccgagcactgcgcccag
aagtttaccgtggagccgtgcgatgtggtgcaacccgatggcagtgtgatctcctatccg
gaactggaggtgcgcgaggagaggatatcggtaaagcgcgccaatgcctatattggcatc
gatgagccggcggaaaagctcgcagatatgctgacgcgcatgtatctggaggccaaggtc
gatggcgactcgctggtggttaagatcccgcccacacggcacgacgtcatccacgcgtgc
gacatctacgaggacgtggctattgcctacggctacaacaacattaagaagtccctgcct
gcattcatgcaaattgccaagcaattcccacttaacaaactgaccgaacaactgcgcgaa
caggtggcccaggcgggcttcaccgaggcgctgacctttacgctctgctcacgggatgac
attgggcgcaagctgaacaagaacatcgacgccttgccggccgtgcacataggcaatccc
aagaccctggagttccaagtagtgcgcacgaccctattgcccggtctcctcaagacgctg
gtggccaatcgcaagatgccgctacccctgaagctcttcgagatcagcgacgtggtggtt
gcggatgagagcacggaagttggtgctcgcaatgagcgaagggtgtgtgctgtaaactgc
aataagaccgctggtttcgaggtggttcacggcctgctagatcgcgtgatgcaattgctc
tctgtgccctggaaatcggccagcgggaccaagggctattaccttcaggccaccgaggat
cccagctacttccccggtcgctgtgctaatgtaatgtacgacggtgttgtcatcggcaag
attggggttttgcatcccacagtgctgcaagccttcgagctgaccacgccttgttcggcg
gtggaattcaccattgagcctttcgtctaa

DBGET integrated database retrieval system