KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5748Help
Entry
Dmel_CG5748       CDS       T00030                                 

Gene name
Hsf
Definition
(RefSeq) heat shock factor, isoform A
  KO
K09414  heat shock transcription factor 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG5748 (Hsf)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Helix-turn-helix
   Heat shock factors
    Dmel_CG5748 (Hsf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSF_DNA-bind Vert_HS_TF HALZ MACPF
Motif
Other DBs
NCBI-GeneID: 37068
NCBI-ProteinID: NP_476575
FlyBase: FBgn0001222
UniProt: P22813
Structure
PDB: 

Position
2R
AA seq 691 aa AA seqDB search
MSRSRSSAKAVQFKHESEEEEEDEEEQLPSRRMHSYGDAAAIGSGVPAFLAKLWRLVDDA
DTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGL
RFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSKILTDVKVMRGRQ
DNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFLITIVQPSRNMSGVKRHVQ
LMINNTPEIDRARTTSETESESGGGPVIHELREELLDEVMNPSPAGYTAASHYDQESVSP
PAVERPRSNMSISSHNVDYSNQSVEDLLLQGNGTAGGNILVGGAASPMAQSVSQSPAQHD
VYTVTEAPDSHVQEVPNSPPYYEEQNVLTTPMVREQEQQKRQQLKENNKLRRQAGDVILD
AGDILVDSSSPKAQRTSIQHSTQPDVMVQPMIIKSEPENSSGLMDLMTPANDLYSVNFIS
EDMPTDIFEDALLPDGVEEAAKLDQQQKFGQSTVSSGKFASNFDVPTNSTLLDANQASTS
KAAAKAQASEEEGMAVAKYSGAENGNNRDTNNSQLLRMASVDELHGHLESMQDELETLKD
LLRGDGVAIDQNMLMGLFNDSDLMDNYGLSFPNDSISSEKKAPSGSELISYQPMYDLSDI
LDTDDGNNDQEASRRQMQTQSSVLNTPRHEL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggtcgcgttcatccgctaaagccgtgcagttcaagcacgaatcggaggaagag
gaagaagacgaggaggagcagctgccttccaggagaatgcactcttacggagacgccgcg
gccatcggaagcggggtgccggcctttttggccaaattgtggcgcctggtggacgatgcc
gataccaatcgcttgatttgctggaccaaggatggccaaagtttcgttatacaaaatcaa
gcgcaattcgccaaggaactattgccactaaactacaagcacaacaacatggccagcttc
ataaggcaattgaatatgtatggattccacaagatcacctctattgacaatggcggacta
cgttttgatcgcgacgagattgaattttcgcacccattttttaagcgcaactcgcctttt
ctacttgaccaaatcaaaaggaaaatatcgaacaacaaaaatggtgacgacaaaggtgtc
ctgaagccggaggccatgtcgaagattctcaccgatgtgaaagtcatgcggggtcgtcag
gacaatctggattcgcgcttctccgccatgaaacaggagaacgaagtgctgtggcgcgag
atagccagcctgcgccaaaagcacgctaagcagcaacaaatagtcaacaaactgatccag
ttcctcattaccattgtgcaaccgtcgcgcaacatgtctggcgtgaaacgccacgtgcag
ctgatgatcaacaatacgccggaaattgatcgtgcacggaccaccagtgagaccgagagc
gagagtggcggcggaccggttatccacgagcttagggaggagcttcttgatgaggtgatg
aatccatcaccggctggctacaccgcagcctcacattatgaccaagagagcgtctctccg
cctgccgttgagcgtccgcgatctaacatgagcattagctcgcacaacgtcgattattcg
aatcagagtgtggaggacttgctgctccagggaaatggaaccgctggcggtaatattcta
gtaggcggagccgcttctcccatggcccaaagtgtgagtcaatcgccggcccaacatgat
gtctacacagtcaccgaggcgcccgattctcatgtccaggaggtgccaaacagtccgcct
tattacgaggagcagaatgtgcttaccacgcccatggtgcgggagcaggagcagcagaag
cgtcagcagcttaaggagaacaacaagctacgacgacaggcaggagatgttatacttgat
gctggagatattctcgtagatagttcgtcgcccaaggcgcaacggacaagcatccagcat
agtacgcaacctgatgtgatggtccagccaatgattataaagtctgagccggagaacagt
tccggactgatggatctaatgactcccgcgaacgatctgtacagtgttaacttcatcagt
gaggatatgccgacggatatttttgaagacgctctgcttcccgacggcgtggaagaggca
gccaaactggaccagcaacaaaaatttgggcaatcgacagtgagcagcggcaagtttgcc
agcaacttcgatgtgcccaccaacagtacgctgctggatgccaatcaggcctcgacatcg
aaggcagcggccaaggcgcaagcatctgaggaagagggcatggctgtggccaaatacagt
ggcgctgagaacggaaacaaccgcgataccaacaacagtcaactcctcaggatggcctca
gttgacgaactccacgggcacttggaaagcatgcaagatgagttggaaacactgaaggat
ctgctgcgtggcgatggggtggccattgatcagaacatgctcatgggtctgtttaacgac
tctgatctaatggacaactatggcctatcgtttcccaatgacagcataagcagtgaaaag
aaagcacccagtggctctgaactgatttcctatcagcccatgtatgatctgtccgacatt
ttggacacggacgatggcaacaatgaccaggaggccagcaggcgccagatgcagacgcaa
agttcggttttaaatacgccacgtcacgagttgtaa

DBGET integrated database retrieval system