KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5821
Entry
Dmel_CG5821       CDS       T00030                                 

Gene name
qkr58E-2
Definition
(RefSeq) quaking related 58E-2, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: KH_1 Qua1
Other DBs
NCBI-GeneID: 37562
NCBI-ProteinID: NP_001286724
FlyBase: FBgn0022985
UniProt: Q9W254
Position
2R
AA seq 416 aa
MAENGLRVPGSSAVASAVASTATGVGGGSAAGTAGAGTGVVPTGVSGGTSNGEHENEHNA
NADGEKAQPAPAVQKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRDQYADV
YQQRTIKLSQKVHVPIKDKKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRARE
EELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYR
ELMEDPEAAKKLTLRQLQQQSNAAASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQRSGGN
YRQKFQQQSHYRHNEETVYFRSHNNAYHQPKPYVPAAQRGNAMHTTLPPQAIVRASPPGM
VVSAASFNGRNAGLGNAGGGGIMANSIVATTGGGIGGAVPPNMRYRPAAPYQFVKK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcggagaacggactgcgcgtgccagggtcatccgcggtggcctctgcggtggcttcc
actgcgacgggagtcggcggtggatcagcagcgggaactgcgggggccgggacaggagtg
gtgcccaccggcgtcagcggcgggacgagcaacggggagcatgagaacgaacacaacgcc
aacgcagacggcgagaaggcccagccggcgccggcggtccagaagtacatgcaggagctc
atgacggagcgatcgcgcatggaaaaccacttccccctggcggtgaagctaattgacgaa
gctctggagcgtgtgcagctaaacggacgcattcccacgagagaccagtacgccgatgtc
taccagcagcgcaccatcaagctgtcccaaaaagtgcacgtgcccatcaaggacaagaag
ttcaactatgtgggcaagctactggggcccaagggcaactcactgcgtcgcctgcaggag
gagacgcagtgcaagatcgtcatacttggtcgcttctcaatgaaggatcgcgcacgtgag
gaggagctgcgcaactccgcggacgcgaagtacgcccacctgaatcttcctctgcacgtc
gaggtgtccaccattgctccgcccgccgaggcgtacgctcgggtggcgtatgccctggcc
gagattcggcggtacctcacgccggacaagcacgatgacatccgccaagagcagtaccgc
gaactcatggaggatccggaggcggccaagaagctgacgcttcgccagctgcaacagcag
tcgaatgcggcagctagtggtgcaggaggaggaggcggtggtggaggcggaaacggaaat
ggcggcgcagctggatccggcagcaataatggcaatgggaaccagcgctccggcggcaac
tacagacaaaagtttcagcaacaatcacactatcgccacaacgaggagactgtctatttt
cgctcacacaacaatgcgtaccaccagccaaaaccctatgtgccagccgcccaacggggc
aatgccatgcacaccaccttgccaccgcaagcaattgtgcgagcctcaccgcccggaatg
gtcgtcagtgcggccagcttcaatggccgaaatgccggactgggtaatgccggcggtggc
ggaatcatggccaatagcatcgtggccaccactggcggtggcatcggtggcgctgtgccg
cctaacatgcgttaccgtcccgctgccccctaccagtttgtcaagaaataa

DBGET integrated database retrieval system