KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5848Help
Entry
Dmel_CG5848       CDS       T00030                                 

Gene name
cact
Definition
(RefSeq) cactus, isoform E
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG5848 (cact)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG5848 (cact)
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG5848 (cact)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    Dmel_CG5848 (cact)
Membrane trafficking [BR:dme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dmel_CG5848 (cact)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 DUF424
Motif
Other DBs
NCBI-GeneID: 34969
NCBI-ProteinID: NP_001260496
FlyBase: FBgn0000250
UniProt: Q03017 M9PD95
Position
2L
AA seq 500 aa AA seqDB search
MPSPTKAAEAATKATATSDCSCSAASVEQRAPSNAANPSSSLATSGKIGGKTQDQTAAIN
KQKEFAVPNETSDSGFISGPQSSQIFSEEIVPDSEEQDKDQQESAPQKEQPVVLDSGIID
EEEDQEEQEKEEEHQDTTTATADSMRLKHSADTGIPQWTVESHLVSRGEQLNNLGQSSST
QITGRSKVQSSTASTANANPSGSGATSSAPPSSINIMNAWEQFYQQNDDGDTPLHLACIS
GSVDVVAALIRMAPHPCLLNIQNDVAQTPLHLAALTAQPNIMRILLLAGAEPTVRDRHGN
TALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNY
DGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNEDLANFLLDECE
KLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAETVTPPDSDYDSSDIEDLDDTKMYD
RFGDPRYFVSYNGGNPMTVA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcccaacaaaagcagcggaggcagcaacaaaggcaacagcaacaagtgactgc
agctgcagcgctgccagtgttgagcagcgcgccccctcaaacgcggctaacccctcgtcc
tcactagccactagcggtaaaattggcggcaaaacacaagatcaaacggccgccattaac
aagcaaaaggaatttgccgtgccaaacgaaaccagtgattcgggcttcatctccggcccg
caatcctcgcagatcttcagcgaggagatagtccccgatagcgaggaacaggataaggat
cagcaggagtcggcaccccaaaaggaacagcccgttgtcctcgattccggtattatcgac
gaagaagaggatcaggaggagcaggagaaagaggaggagcaccaggacaccaccactgcc
accgccgattcaatgcgactcaaacacagcgcggacacaggcatcccacaatggaccgtc
gaaagccatttggtcagtcgcggcgaacagcttaacaatctcggccagagcagcagcacc
caaatcaccggtcgcagcaaggttcaatcctccacagccagcacggcgaacgcgaatcct
tcgggatcgggagcaacatcatccgctccgcccagcagcattaatatcatgaacgcctgg
gagcagttctatcaacaaaacgacgacggcgacacacctttgcacctggcctgtatttcg
ggatcagtggacgtggtggccgccctgattcgcatggctcctcatccgtgcctgctcaac
atccagaacgatgtggcccagacaccccttcatctggccgctcttactgcccagccgaac
atcatgaggatacttttactcgccggagctgagcccacggtgcgcgatcgtcatggaaac
acagctctgcatctttcctgcatcgccggagagaaacagtgcgtccgtgccttgacagag
aagttcggcgccacggaaatccatgaggcccaccgacaatatggacaccgatccaacgac
aaagcggtcagttccctgagctacgcctgcctgcccgccgatctggagattcgcaactac
gatggagaacgctgtgtgcatttggccgccgaggcgggtcacattgatatcttacgcatt
ttggtatcccatggagcagacattaacgccagggagggaaaatcgggccgcacaccgctg
cacattgcgatcgagggctgcaacgaggatctggccaacttcctgctcgatgagtgcgag
aagctgaacctggaaacggccacctacgccggcttgacggcctaccagtttgcgtgcatc
atgaacaagtcgcgcatgcagaacatcctggagaagcgcggagcggagaccgtaacgcct
ccggacagtgattacgacagtagcgatatcgaagatctagacgatacgaagatgtacgat
cgctttggtgatcctcgctattttgtcagctacaacggtggcaatcccatgacagttgcc
tga

DBGET integrated database retrieval system