KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5851Help
Entry
Dmel_CG5851       CDS       T00030                                 

Gene name
sds22
Definition
(RefSeq) sds22
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG5851 (sds22)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG5851 (sds22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8 LRR_6
Motif
Other DBs
NCBI-GeneID: 42091
NCBI-ProteinID: NP_650619
FlyBase: FBgn0028992
UniProt: Q9VEK8
Position
3R
AA seq 326 aa AA seqDB search
MGDADRAMNEPEAAKTVSGIQVIPAEDVASIEDIITIDPDCYELDLNHRRIEKLENFEPL
TRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKI
ENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGK
NKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLE
TLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDV
RYRSKLRDILPQLQKIDATLCKVPGT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatgctgatcgtgcgatgaacgaaccagaagccgcgaaaactgtgtccggaatc
caggtgattcccgccgaggatgtggcttccattgaggatataatcacaatcgatccggac
tgctacgagcttgatctgaatcatcgccggatcgagaagctggagaacttcgagccgctg
actcgaatcgagcgcctgtttctgcgctggaatctgatcaagaaaatcgagaacttgtcc
agcctgaaaacactgattgagctggagctgtatgacaaccagatcaccaagattgagaat
ttggacgacttgccccacctggaggtgctggacattagcttcaatcgtctgacgaagata
gagaaccttgacaagctggtcaagctggagaaggtctactttgtgtcgaaccggataacc
caaatcgagaacctggacatgctcaccaatctgaccatgctagagctgggggataacaaa
ctgaagaagatcgaaaacatcgaaatgctcgtgaatctacgacagctcttcctgggcaaa
aataagatagcaaagatcgagaacttggacacattggtcaatttggagatactcagtcta
caggccaatcgcattgtaaaaatcgagaaccttgaaaagcttgccaacctccgcgaactc
tacgtttcggaaaacggagtggaaaccattgaaaacctctcggagaacaccaaattggag
accctcgacttggccaagaaccggttgaagggcattgccaatctggaaaagctggaactg
ctcgaggagctgtggctgaaccacaacggagtcgatgactggaaggacattgagctgttg
aaggtgaacaaggcgctgcagaccatctacctggagtacaatccgctggccaaggatgtt
cgctaccgctccaaactgcgcgacatactgccgcagctgcagaagattgatgccaccctg
tgcaaggtgcccggtacctag

DBGET integrated database retrieval system