KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5920
Entry
Dmel_CG5920       CDS       T00030                                 

Gene name
RpS2
Definition
(RefSeq) ribosomal protein S2, isoform B
  KO
K02981  small subunit ribosomal protein S2e
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dmel_CG5920 (RpS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dme03011]
    Dmel_CG5920 (RpS2)
Ribosome [BR:dme03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    Dmel_CG5920 (RpS2)
SSDB
Motif
Pfam: Ribosomal_S5 Ribosomal_S5_C ATP_synth_reg
Other DBs
NCBI-GeneID: 34309
NCBI-ProteinID: NP_001260303
FlyBase: FBgn0004867
UniProt: P31009 M9PB84
Position
2L
AA seq 267 aa
MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLGRLVREGKIKS
LEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHI
GLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIP
APRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWK
EMPLGSTPYQAYSDFLSKPTPRLHADA
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcggacgaagctccagcccgtagtggattccgtggcggatttggctctcgtggtggt
cgtggtggacgcggtcgtggccgtggacgctgggcccgtggacgtggaaaggaggactcc
aaggagtgggtgccagtgaccaagctgggacgcctggtgcgcgagggcaagatcaagtct
ttggaggagatctacctgtactcgcttcccatcaaagagttcgagatcatcgacttcttc
ctgggatcctcgctgaaggatgaggtgctgaagatcatgcccgtccagaagcagacccgt
gctggtcagcgtacccgtttcaaggccttcgttgccatcggcgacaacaatggccacatt
ggtctgggcgttaagtgcagcaaggaagtggccaccgccatccgtggtgccatcattctg
gccaagctctccgtggtgcccgtgcgccgtggctactggggcaacaagatcggcaagccc
cacaccgtgccctgcaaggtcaccggcaagtgcggttccgtctccgtgcgcctcatcccc
gctccccgtggtactggcattgtctcggcccccgtgcccaagaagctgctgaccatggcc
ggtattgaggattgctacacctcggcccgtggctccactggaaccctcggcaacttcgcc
aaggctacatatgccgccatcgccaagacgtacgcgtacttgacccccgatctgtggaag
gagatgcctctgggctccactccttaccaggcatactcggacttcctgtccaagcccact
cctcgtctgcacgccgatgcctaa

DBGET integrated database retrieval system