KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5942
Entry
Dmel_CG5942       CDS       T00030                                 

Gene name
brm
Definition
(RefSeq) brahma, isoform A
  KO
K11647  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2/4 [EC:3.6.4.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dme03021]
    Dmel_CG5942 (brm)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG5942 (brm)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Dmel_CG5942 (brm)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     Dmel_CG5942 (brm)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    Dmel_CG5942 (brm)
   PBAF complex
    Dmel_CG5942 (brm)
SSDB
Motif
Pfam: SNF2_N Helicase_C BRK Bromodomain HSA SnAC QLQ ResIII
Other DBs
NCBI-GeneID: 39744
NCBI-ProteinID: NP_536746
FlyBase: FBgn0000212
UniProt: P25439
Position
3L
AA seq 1638 aa
MASPSPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPGAYGHPMQ
HGPPGQGPPGHHMPPHHQGMIFSKGPHMGMQMPPTGPNMSPYQTHGMPPNAPTQPCIVSP
GGPPGGPPPPERSSQENLHALQRAIDSMEEKGLQEDPRYSQLLAMRATSKHQHLNGNQVN
LLRTQITAYRLLARNKPISMQMQQALQAAQQQPPPGPPIGPPGAPGGPPPGSQHAGQPPV
PPQQQQQPPPSAGTPPQCSTPPASNPYGPPVPGQKMQVAPPPPHMQQGQPLPPQPPQVGG
PPPIQQQQPPQQQQQQSQPPPPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQPQVRGTL
PGMPPGSQVPQPGGGPQRQVPPAGMPMPKPNRITTVAKPVGLDPITLLQERENRIAARIS
LRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLY
KRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLAR
MNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDE
YISNLTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHVVEQC
TGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKA
QATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKG
LEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLE
FEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIID
EGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQ
WFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMS
ALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCD
HTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFG
YLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQ
DLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSE
RQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGR
ERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDD
GAEFDEEEEEDDSKRKRRKRKNRKEESDDDSLILKRRRRQNLDKRSKKQMHKIMSAVIKH
NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQ
NAQIYNEEASLIYLDSIALQKVFVGARQRITAAADAAAVAAGDNTGEAHGNGGSDNSDND
DDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPTQSSSNVSSGAATTSKKQTRR
KRSQKKYTISDDDDDDMD
NT seq 4917 nt   +upstreamnt  +downstreamnt
atggcctcgccctctccggcgaacagtcccatgccaccgccacaggcgcccagtccgatg
gccccgccctcgcagagtcccgccccctcgccgcacagcccgtatccgcaccagcagccg
ggtccactgcaaggacctccgccacccggacatcccggtgcctacggacatcccatgcag
cacggaccacccggccagggtccacccgggcatcatatgccaccgcaccaccaggggatg
attttctcaaaaggtccgcacatgggaatgcagatgccgccgacgggaccgaacatgtcc
ccctaccaaacccacggaatgccacccaatgcacccacacaaccctgcatagtgtcacct
ggtggcccacctggaggcccgccacctccggagcgctcgagccaggagaacctgcacgcg
cttcaacgcgccattgattcaatggaggaaaagggcttgcaagaggatcctcgctactcg
cagctgctggcaatgcgagcaacctcgaagcatcagcaccttaatggcaatcaggttaac
ttgttgcgcacacagatcaccgcctatcggttgctggcgcggaacaagcccatatccatg
cagatgcagcaggcgttgcaggccgcacagcaacagccaccgccaggacctccaattggg
ccacctggagcaccaggcggaccgccaccagggagccagcatgcaggacaaccgcccgtg
ccgccgcaacaacagcaacaaccgccaccttcagcaggaactccaccccagtgctccacg
ccgcccgcaagcaatccttatggaccgccagttcctggccagaaaatgcaggtagcgcca
ccaccgccacacatgcaacagggacagccattgccaccacaaccgccacaagtgggtgga
cccccgcctatacaacagcagcaaccacctcagcagcagcaacaacagtcgcagcccccg
ccaccggagccacatcagcaccagttgccaaacggaggcaaacccctgagtatggggcca
tctggcgggcaaccactaataccttcatcacccatgcagccacaagtgagagggacactg
ccaggaatgccgccaggtagtcaggttccgcaaccaggaggaggtcctcagcgacaggta
ccacctgcgggcatgccgatgcccaagcccaatcgcattacaacggtggccaaacccgtc
ggtctggatcccataacattgctgcaggaaagggagaataggatagcagccaggatatca
ttgcgcatgcaggagttgcagcgactgccggccacgatgtccgaggatctgcgtctgcaa
gcggctatcgagttgagggccctaagggtcttgaacttccagcgacagctgcgtatggag
tttgttcagtgcacgagacgagataccactttggaaacagcgttaaacattaagctctac
aagaggaccaagaggcagggcctgcgggaggcacgtgccaccgagaagctagagaagcaa
cagaagctagaggctgaacgaaagcgtcgccaaaagcatctggagttcttggctgctgtg
cttcagcacggcaaggatctaagggagttccacagaaataataaggcccagcttgcaagg
atgaacaaggccgtgatgaatcaccacgccaatgccgagcgtgaacagaagaaggaacaa
gagcgcatcgaaaaggaacgtatgcgacgtctgatggccgaggatgaggagggttaccgc
aagctgattgatcaaaagaaggacaagagattggctttcctactgtcgcagacagatgag
tatattagcaacctaactcagatggtgaaacagcacaaggacgaccagatgaagaaaaag
gaggaggagggcaagcggctgatacagttcaaaaaggagctgctgatgagcggagagtac
attggcattgatgagggcagcattgttgccgatatgcgggtacatgtggtggaacagtgc
acgggtaagaaactcaccggcgatgatgcacccatgctgaagcacttgcaccgctggctg
aatatgcatcctggctgggattggatcgacgacgaggaggacagctgtgggagcaacgac
gatcataaacccaaggtggaggagcaaccaacggcaacagaagatgccaccgacaaagcg
caggcgacgggcaacgatgaggatgccaaggatctaattaccaaggccaaggtggaggac
gatgagtacaggacggaggaacagacgtactacagcatcgctcataccattcatgaaaag
gttgtggagcaggccagcatcatggttaatggtacgctcaaggaataccagatcaaaggc
ttggagtggttggtttcgctgtacaataacaatctaaatggtattttggccgatgaaatg
ggtttgggtaaaaccattcaaaccatttcgctggtaacctaccttatggatcgaaagaag
gttatgggtccttacttgattattgtaccactctccaccctgcccaattgggtgctggaa
ttcgagaagtgggcgccagccgtgggtgtagtcagctacaagggcagtccgcagggaagg
cgattgctgcaaaatcaaatgagagcaaccaagttcaatgtgctgttaaccacatatgag
tacgtgattaaggacaaggcggtgctggccaagatccagtggaaatacatgattatcgac
gagggtcaccgcatgaagaaccatcactgcaaactcacccaggtgctgaacacccactac
attgccccctatcggttacttctcacgggtacacctctgcaaaacaagcttcccgagttg
tgggcgctacttaatttcctgctgccctcgatctttaagtcctgctccacatttgaacag
tggttcaatgcgccatttgccaccactggcgagaaggtcgagctaaacgaggaggagacc
atccttatcattcgtcgtctgcacaaggttcttcgtcctttcctgttgcgtcgcctcaaa
aaggaggtagagcaccagctgcccgacaaggtcgagtacatcatcaagtgcgacatgtcc
gcgctgcaacgcgttctctacaagcacatgcagagcaagggtgtcctgctcaccgatggt
tccgagaagggcaagcacggcaagggaggcgctaaggcgctgatgaacacgatcgtacag
ctgcgcaagctgtgcaaccatccgtttatgttccagcacatagaagagaagtactgcgat
cacactggcggccacggagttgtatccggaccggatctgtatcgtgtctctggcaaattc
gagctgcttgatcgcatcctgcccaagctgaaggcgaccaatcatcgcgtgctgctcttc
tgtcagatgacccaatgcatgaccatcatcgaagactacctgggatggcgccaattcggc
taccttcgactcgacggtaccacgaaggccgaggatcgtggcgaactactgcgaaaattc
aacgccaaaggctcggatgtatttgtctttttgctatctacccgagctggtggtttgggt
cttaatctgcagaccgccgatactgtagtaatcttcgactccgattggaatccccatcag
gatctgcaagcccaggatcgtgcccatcgtattggtcaacgtaacgaggtgcgcgtcctg
cgactaatgacagtcaactcggtggaagagcgcatcttggcagcagccaggtacaagctg
aacatggacgagaaggtcatccaggctggtatgttcgatcagaagtcaacgggtagcgag
cgacagcagttcctacaaacgattctgcaccaggatgacaacgaagaggaggaggaaaat
gaggtgcccgatgacgaaatgatcaacatgatgatcgcccgcagcgaggaggagattgaa
atatttaagcgcatggatgctgagcgcaagaaggaggatgaggagatccatccgggtagg
gaacgtctgatcgatgagtccgagctacccgactggttgacaaaggatgatgacgaagta
gagcgtttccactatcagtacgacgaggataccattctaggtcgaggctcccggcagcga
aaggaagtagactacaccgatagtttgactgaaaaggagtggctgaaagccatcgacgat
ggcgctgagttcgacgaggaagaggaggaagacgattcgaagcgcaagcgacgaaagcgt
aagaatcggaaggaagagtccgacgatgattcgttgatcctaaaacggcgacgacgccaa
aatctggacaagcggtccaagaagcagatgcacaagattatgagtgcggttatcaagcac
aaccaagatggacgaaccctgtccgaaccgttcatgaagttgccttcgcggcagaggttg
cccgactactacgagatcattaagcggccagttgatattaagaaaatcctgcagcgcatt
gaggactgcaagtatgccgatctcaacgagctggagaaggactttatgcagctatgccag
aatgcacagatctacaacgaagaggcgtctctgatttacctggactcgattgccctgcaa
aaggtattcgttggggccaggcagaggataacagctgcagcggatgcagccgcagtggca
gccggagataacacgggtgaagcgcacggcaatggaggttcggataattcggacaacgac
gacgacgatggtggcgatgacggctccgacgacgaggagattgcaaccacttcagcggcg
gctgtcaaaatgaagctgaaactgaacaaatctctggctagtgcgcccgctacgcccacg
caatcatcgtcgaatgtgagcagcggagcggctaccacatccaagaagcagacgcgtcgc
aagcgctcccaaaagaagtacactatttcagacgatgacgacgatgacatggactag

DBGET integrated database retrieval system