KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5978
Entry
Dmel_CG5978       CDS       T00030                                 

Gene name
GAPsec
Definition
(RefSeq) GTPase activating protein, SECIS-dependent read-through
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: RabGAP-TBC
Other DBs
NCBI-GeneID: 38987
NCBI-ProteinID: NP_648245
FlyBase: FBgn0035916
UniProt: Q9VSM8
Position
3L
AA seq 403 aa
MSIFKARVKEFEDVLAGPQDLIDLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSW
TTTLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGLQDHPLSEGPESAWN
TFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSA
NVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEI
VGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNM
LKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKI
CCSMILIQREAILENDFASNVKLLQNYPPIDINVVIAHAGSLA
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgtctattttcaaggcgcgagtcaaggaatttgaggatgttttggcggggccacaggat
ttaattgacctgaaacaactcaggaaactggcatttaatggtgtgcccgatgtgcagagt
tttcgagcactcagttggaagctactccttggctatttggggcctaggcgcagtagttgg
accacaaccttggcccaaaagcgagccctgtataaacagttcatcgaggagctagtcctg
ccccccggacactcgagcaatagagctagcgtagacggaggagatggggacaaagtcgat
tcggggggcgttggcctgcaagatcatccgctgagcgagggacccgaaagcgcgtggaac
acgttcttcaatgataacgagtttctactgcaaatcgacaaggatgtccgccgcttgtgc
ccggacatatcctttttccagcagcccaccgattatccctgcgagattgtggtccacagc
aaaggagagcatggacgaaggctccacgaacgggtggttcccgccgttctaagttcggcg
aatgtggaacgcaagggcctcggcatgacaaagataaatttgattacaaaacgctccgtt
gaaaactatgccgccatggaggagggccaagaggctcactgggaagttgtgcaacgcatt
ttgttcatctatgccaaactaaatcccggccagggatatgtccagggcatgaacgaaatc
gtgggacccatttactatgttatggcctccgatcctgacctcacatatcgcgcccacgct
gaggctgattgtttcttttgttttaccgccctgatgagcgagataagagacttttttatt
aaaacactagacgacgcagaaggcggcatcaagttcatgatggccaggctatcgaatatg
ctgaaatcaaaggacctaagcatttacgagctactcaggagccaagagctgcatccgcag
tattacagcttcaggtggctcacactgctcctgtcgcaggagtttccactgccagatgta
ctgcgcatttgggattccgtgtttgcggacgaacagcgatttgattttctgataaaaata
tgctgttcaatgatattaatccaaagggaagcaattttggaaaacgactttgcctcgaat
gtgaaactcttgcaaaactatccgccaattgacattaatgttgtgattgctcatgccgga
tcattggcgtag

DBGET integrated database retrieval system