KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5992
Entry
Dmel_CG5992       CDS       T00030                                 

Gene name
Adgf-A
Definition
(RefSeq) adenosine deaminase-related growth factor A, isoform A
  KO
K19572  adenosine deaminase CECR1 [EC:3.5.4.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00230  Purine metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG5992 (Adgf-A)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     Dmel_CG5992 (Adgf-A)
SSDB
Motif
Pfam: A_deaminase_N A_deaminase
Other DBs
NCBI-GeneID: 39976
NCBI-ProteinID: NP_524130
FlyBase: FBgn0036752
UniProt: Q9VVK5
Position
3L
AA seq 553 aa
MSPVIRRNLIACLTLGLCVCLSFGPGPVESRTRPKNQVDRKLLTIYGSTPHVEALLGPGR
PTPDTYKTLRSAFFRYEESRSLGHDLDLNSREIKANETIMKAKLKEFDEGLVTPHLFKPS
QHIFDVLDGIRNTDLFKLLKKMPKGAVLHAHDTALCSTAAIINLTYYEHLWSCQQDGDLS
ASALRFSKDKPQALSDCDWSLLSDVRAKYGADKVDDYLAERLTLYPTKKFEDNNAAWSTF
MSIFNLLDGLVMYAPVWADYYYKALEEFYEDGVLYLEFRSVVPTLYDMDGTEFTPMDTVR
IYVETLEKFKEAHPDFIGSRMIYAPIRYTNAEGVTGYIQTLKQIKEKYPEFVAGFDLVGQ
EEMGRPLRDFVDELLSIPDDIDFYFHAGETNWFGSTVDENLIDAILLGTKRIGHGFGLVK
HPVVLDMLKKLNVAIEVNPISNQVLQLVSDFRNHPCSHFFADGYPVVISSDDPSFWKATP
LTHDFYIAFLGIASQHSDLRLLKKLALNSIQYSSLTGDAQFEALEKWQVKWDQFIADVND
RSSNRGSPSQRID
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtcgccagtcatccgccgtaatcttatcgcctgtctcactttgggcctgtgcgtctgt
cttagcttcggaccgggtccggtggaatcacgcactcgcccgaagaaccaggttgataga
aagctgttgacgatctacggcagcacgccccacgtggaagcccttctgggtccaggtcgt
cccacgccggatacctacaagacgttgagaagcgcctttttccggtacgaggaatcacgc
tcattgggccatgacctggatctaaatagcagagaaattaaggctaacgaaaccattatg
aaggccaaattaaaggagtttgacgaaggcctggttacccctcacctcttcaagccctca
cagcacatatttgatgtgttggacggcatccggaacaccgatctcttcaagctgctgaaa
aagatgcccaagggcgcggttcttcatgcccacgatacggcgctctgcagcacagcggcc
attatcaacctgacctactatgagcatctctggtcctgccagcaggacggagatcttagc
gcctccgccctaaggttttccaaggataagccacaggccctcagtgactgcgattggagt
ctgctctccgatgtgcgagccaaatacggagctgacaaggtcgatgactatctggccgag
agactcacactgtatccaaccaagaagtttgaggacaacaatgccgcctggtccacgttc
atgtccattttcaatctgctcgacggtctggtgatgtacgcccccgtctgggcggactac
tactacaaagcgctggaggagttctacgaagatggtgttctatacttggaattccgatca
gttgttcccacgctatatgacatggatggaacggagtttactcctatggatactgtgcgc
atttatgtggaaaccttggagaagttcaaggaggctcatccagatttcattggttcaagg
atgatctatgctcctatacgttatacgaatgcagagggcgtaactggctatatccaaacc
cttaaacaaataaaggaaaagtacccggaatttgtagctggtttcgatttggtgggccag
gaggagatgggacgtcctttgagggactttgtcgacgaattattatctatccccgatgac
attgatttctacttccacgccggagaaacaaactggttcggttccactgtggatgagaac
ctgatcgatgccattttgctgggcacaaagcgtattggtcatggattcggactggtcaaa
catcccgtggtgctggacatgctgaaaaagctgaatgtggccattgaagtgaatccgatt
tcgaatcaagtgctccagctggtctctgacttccgcaaccatccgtgctctcacttcttc
gccgatggctatccagtggttatatcctcggatgatccctccttctggaaagccactccc
ctgacgcatgacttctatatcgccttcttaggaatcgcctcgcagcactccgacttgcgt
ctgctgaagaagttggccctaaattcgatacaatatagttctctgacgggagacgcccag
ttcgaggcgctggaaaagtggcaggttaaatgggaccagttcatcgccgatgtcaatgat
cgttcctccaaccggggatcccccagtcaacggatcgattga

DBGET integrated database retrieval system