KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6042
Entry
Dmel_CG6042       CDS       T00030                                 
Name
(RefSeq) Cyp12a4
  KO
K15004  cytochrome P450 family 12 [EC:1.14.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dme00199]
    Dmel_CG6042
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Dmel_CG6042
Cytochrome P450 [BR:dme00199]
 Cytochrome P450, animal type
  CYP12 family
   Dmel_CG6042
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 42294
NCBI-ProteinID: NP_650783
FlyBase: FBgn0038681
UniProt: Q9VE00
Position
3R
AA seq 536 aa
MLKVRSALSLIQSQKATLSLATQKRWQTNVATAEAREDSEWLQAKPFEQIPRLNMWALSM
KMSMPGGKYKNMELMEMFEAMRQDYGDIFFMPGIMGNPPFLSTHNPQDFEVVFRNEGVWP
NRPGNYTLLYHREEYRKDFYQGVMGVIPTQGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQ
VNQEFVQRILELRDPDTLEAPDDFIDTINRWTLESVSVVALDKQLGLLKNSNKESEALKL
FHYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQEVTLAYVDEAIERLDKEAKE
GVVRPENEQSVLEKLLKVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLR
EEVMKVLPNKNSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGYRVPAG
TYVNIVPLNALTRDEYFPQASEFLPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPR
MCVGKRIVEMELELGTARLIRNFNVEFNYPTENAFRSALINLPNIPLKFKFIDLPN
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgctaaaagttcgcagtgctctatcattaattcagtcgcaaaaagcgactctctcgctc
gccactcaaaagcgctggcaaactaatgtggcgactgcagaagctagagaggattcggaa
tggctgcaggctaagccatttgagcagatccctcgactcaacatgtgggcattgtcgatg
aaaatgtccatgccgggtgggaaatacaagaacatggaactgatggagatgtttgaggcg
atgagacaggactacggcgatatattctttatgccaggtattatgggtaacccaccattc
ctaagcacccacaatccccaggacttcgaggtggtatttcgcaacgagggtgtgtggccc
aatcgtccaggcaactatacattgctctaccaccgcgaggagtacaggaaggacttctac
cagggcgtcatgggcgtcattccgacgcagggcaagccatggggcgactttagaaccgtc
gttaatcccgtgcttatgcagccaaaaaatgtgcgattgtattacaagaagatgtcgcaa
gtcaaccaggagtttgttcagcgcattctcgaactgagagatcccgatactcttgaggct
cccgacgacttcatagacaccatcaaccgctggaccttggaatccgtatccgtggtggcc
ctggataagcaactgggtttgctcaagaactcaaataaggaaagcgaggccctcaagctt
ttccactacctggatgagttctttatagtatccattgatctggaaatgaagccctcgccc
tggcgctacattaaaactcccaagttgaagcgattgatgcgagctttggatggtattcag
gaagtaactctggcctacgttgatgaggctatagaacggctggataaggaggccaaggag
ggcgtggtgcgtccggagaatgaacaaagtgtgctcgagaaactgctgaaggtagacaga
aaggtggccactgttatggccatggatatgctaatggcaggagttgatacgacatcgagc
acctttacagcactattgctgtgccttgccaagaatcccgagaagcaggccaggctcagg
gaggaggtgatgaaggtgctgcccaacaagaattccgaattcactgaagcatcgatgaag
aacgttccctatttgcgtgcctgcataaaggaatcccagcgattgcatcccctgattgtg
ggaaatgctcgcgtccttgccagagatgctgtcctcagtggataccgagtgccagctgga
acttacgtgaacattgttcccctgaatgccctgaccagggatgagtacttcccacaggca
tctgagttcctgccggaacgctggctgcgaagtcccaaggactcggaatcgaagtgtccg
gcaaatgaactgaagtcaacgaatccattcgtatttctgcccttcggatttggaccacgg
atgtgcgtgggcaaacgcattgtggaaatggaactggaattgggtaccgctcgtctcatt
cgcaatttcaacgtggagttcaattatcccacggagaatgcgttccgatctgcattgatc
aacttgccaaacattccgctcaagtttaaattcatcgatttaccaaactaa

DBGET integrated database retrieval system